Recombinant Human IFN-omega Protein, >95%(SDS-PAGE)

Cat. No.: rp147247
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
E. coli
Accession #
P05000
Protein Tag
C-His
Expression system
E. coli
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Measure by its ability to induce cytotoxicity in TF-1 cells. The ED50 for this effect is 0.02 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
20μg
rp147247-20μg
3
66,90US$
100μg
rp147247-100μg
1
210,90US$
1mg
rp147247-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
1.806,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,High Performance,His Tag,PBS Only,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,High Performance,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

IFN-ω is a member of the type I interferon family, that can be induced by virus infected leukocytes and exert antiviral and anti-proliferative activities. IFN-ω shares about 75% sequence homology with IFN-α. There are two conserved disulfide bonds that are necessary for full biological activity.


Specifications

Product Name
Recombinant Human IFN-omega Protein, >95%(SDS-PAGE)
Sinónimos
Interferon alpha-II-1
Grado
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance, His Tag, PBS Only
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, His Tag, PBS Only, ≥95%(SDS-PAGE)
Pureza
>95%(SDS-PAGE)
Bioactividad
Measure by its ability to induce cytotoxicity in TF-1 cells. The ED50 for this effect is 0.02 ng/mL.
Concentración de endotoxinas
<0.1 EU/μg
Sistema de expresión
E. coli
Especie
Human
Aminoácidos
24-195 aa
Secuencia
MCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS
Etiqueta proteínica
C-His
Secuencia N-terminal
Met
Número de adhesión
Peso molecular previsto
20.93 kDa
SDS-PAGE
19.7 kDa, under reducing conditions; 19.7 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Condiciones de almacenamiento de almacenamiento
Store at -20°C
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Lyophilized protein should be stored at -20°C. Upon reconstitution,store at 2°C to 8°C for up to 1 week.Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1%BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should b
Imágenes

Recombinant Human IFN-omega Protein (rp147247) - Protein Bioactivity
Measure by its ability to induce cytotoxicity in TF-1 cells. The ED50 for this effect is 0.02 ng/mL.

Recombinant Human IFN-omega Protein (rp147247)- SDS-PAGE
2 μg/lane of Recombinant Human IFN-omega was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 19.7 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

2 results found

Lot NumberCertificate TypeFechaArticulo
ZJ23F0800935Certificate of AnalysisMar 09, 2026 rp147247
ZJ23F0800934Certificate of AnalysisFeb 10, 2026 rp147247
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.