Recombinant Human B7-H2 Protein

Cat. No.: rp181300
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
O75144-2
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
1. Immobilized Recombinant Human B7-H2 Protein (rp181300) at 2.0 μg/mL can bind Recombinant Human ICOS Protein with the EC50 of 386.7 ng/mL. 2. Immobilized Recombinant Human B7-H2 Protein (rp181300) at 1.0 μg/mL can bind Prezalumab (anti-B7-H2) (Ab170952) with the EC50 of 35.8 ng/mL.
Size
Status
Price
Qty
10μg
rp181300-10μg
≥10
$79.90
50μg
rp181300-50μg
7
$179.90
100μg
rp181300-100μg
7
$269.90
1mg
rp181300-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$1,919.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free, Carrier Free, Bioactive, ActiBioPure™, His Tag, PBS Only, ≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human B7-H2 Protein
Synonyms
B7-H2 | B7 homolog 2 | B7 homologue 2 | B7 like protein Gl50 | B7 related protein 1 | B7-like protein Gl50 | B7-related protein 1 | B7H2 | B7RP 1 | B7RP-1 | B7RP1 | CD 275 | CD275 | CD275 antigen | GL 50 | GL50 | ICOS L | ICOS LG | ICOS ligand | ICOSL | I
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, His Tag, PBS Only
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, His Tag, PBS Only, ≥95%(SDS-PAGE)
Biochemical and Physiological Mechanisms
B7-H2, also known as B7-related protein (B7RP1), ICOS Ligand, and CD275, is an approximately 60 kDa transmembrane glycoprotein in the B7 family of immune regulatory molecules. Mature human B7-H2 consists of a 238 amino acid (aa) extracellular domain (ECD)
Bioactivity
1. Immobilized Recombinant Human B7-H2 Protein (rp181300) at 2.0 μg/mL can bind Recombinant Human ICOS Protein with the EC50 of 386.7 ng/mL. 2. Immobilized Recombinant Human B7-H2 Protein (rp181300) at 1.0 μg/mL can bind Prezalumab (anti-B7-H2) (Ab170952) with the EC50 of 35.8 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Expression System
HEK293
Amino Acids
1-258 aa
Sequence
MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSHHHHHH
Protein Tag
C-His
Accession #
Predicted molecular weight
29.5 kDa
SDS-PAGE
41.8-60.3 kDa, under reducing conditions; 40.4-59.2 kDa, under non-reducing conditions
Molecule Type
Protein
Storage and Shipping
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Images

Recombinant Human B7-H2 Protein (rp181300) - Binding Activity
Immobilized Recombinant Human B7-H2 Protein (rp181300) at 2.0 μg/mL can bind Recombinant Human ICOS Protein with the EC50 of 386.7 ng/mL.

Recombinant Human B7-H2 Protein (rp181300) - ELISA
Immobilized Recombinant Human B7-H2 Protein (rp181300) at 1.0 μg/mL can bind Prezalumab (anti-B7-H2) (Ab170952) with the EC50 of 35.8 ng/mL.

Recombinant Human B7-H2 Protein (rp181300) - SDS-PAGE
3 μg/lane of Recombinant Human B7-H2 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 41.8-60.3 kDa under reducing conditions and 40.4-59.2 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ24F1011663Certificate of AnalysisMay 21, 2026 rp181300
ZJ24F1011664Certificate of AnalysisMay 21, 2026 rp181300
ZJ24F1011665Certificate of AnalysisMay 21, 2026 rp181300
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.