Recombinant Human CASP-1 Protein, >90% (SDS-PAGE)

Cat. No.: rp169566

GRADE & PURITY Carrier Free, Azide Free, His Tag, ≥90%(SDS-PAGE)

Expression System

E. coli

Accession #

P29466

Protein Tag

N-His

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Overview

Purity: >90%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description：
Caspase-1/CASP1 subunit p10 Protein, a thiol protease, intricately participates in various inflammatory processes by catalyzing the proteolytic cleavage of precursor proteins associated with inflammation. This includes interleukin-1 beta (IL1B) and interleukin 18 (IL18), pivotal inflammatory cytokines, as well as the pyroptosis inducer Gasdermin-D (GSDMD), converting them into active mature peptides. Functioning as a key initiator of cell immunity, Caspase-1 activates a pro-inflammatory response upon inflammasome complex formation, leading to the release of mature cytokines IL1B and IL18, which play critical roles in diverse inflammatory pathways. Caspase-1's activity extends to initiating pyroptosis, a programmed lytic cell death pathway, by cleaving GSDMD. Notably, unlike its cleavage of interleukins, the recognition and cleavage of GSDMD depend on an exosite interface on CASP1, emphasizing its versatile and complex regulatory roles. Moreover, Caspase-1 activates CASP7 in response to bacterial infection, promoting plasma membrane repair, and controls antiviral immunity by cleaving CGAS upon inflammasome activation during DNA virus infection. In apoptotic cells, Caspase-1 cleaves SPHK2, which remains enzymatically active extracellularly. Despite its involvement in diverse cellular processes, Caspase-1 is apoptosis inactive.

Specifications

Product Name

Recombinant Human CASP-1 Protein, >90% (SDS-PAGE)

Synonyms

CASP-1 | CASP1 | CASP1_HUMAN | Caspase 1 | Caspase-1 subunit p10 | ICE | IL-1 beta-converting enzyme | IL-1BC | IL1 beta converting enzyme | IL1B convertase | Interleukin 1 beta convertase | Interleukin 1B converting enzyme | Interleukin-1 beta convertase

Grade

Azide Free, Carrier Free, His Tag

Specifications & Purity

Carrier Free, Azide Free, His-Tag, ≥90%(SDS-PAGE)

Purity

>90% (SDS-PAGE)

Endotoxin Concentration

<1.0 EU/μg

Expression System

E. coli

Amino Acids

120-297 aa

Sequence

MHHHHHHNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD

Protein Tag

N-His

Accession #

P29466

Predicted molecular weight

20.7 kDa

SDS-PAGE

20.5 kDa, under reducing conditions

Molecule Type

Protein

Storage and Shipping

Shape

Lyophilized

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Storage

Store at -20°C,Avoid repeated freezing and thawing

Shipped In

Ice chest + Ice pads

Stability And Storage

Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle.

Images

SDS-PAGE: Recombinant Human CASP-1 Protein (rp169566)

Recombinant Human CASP-1 Protein (rp169566) - SDS-PAGE
3 μg/lane of Recombinant Human CASP-1 Protein was resolved with SDS-PAGE under reducing (R) and visualized by Coomassie® Blue staining, showing a band at 20.5 kDa.