Recombinant Human Complement Component C5a Protein

Cat. No.: rp169563
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. ≥95%(SDS-PAGE) expressed in E. coli; See COA
Accession #
P01031
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Testing in progress
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp169563-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$99.90
50μg
rp169563-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$299.90
100μg
rp169563-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$479.90
1mg
rp169563-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$2,799.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,≥95%(SDS-PAGE),expressed in E. coli; See COA Carrier Free for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human Complement Component C5a Protein
Synonyms
C5 | C5A | HE | Complement Component 5a | Complement C5 | C5a anaphylatoxin | CPAMD4 | C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4
Grade
Carrier Free
Specifications & Purity
Carrier Free, ≥95%(SDS-PAGE), expressed in E. coli; See COA
Biochemical and Physiological Mechanisms
Human Complement 5a (C5a) is an enzymatically generated glycoprotein that belongs to a family of structurally and functionally related proteins known as anaphylatoxins. C5a is a 74 amino acid (aa) peptide that is created by the activity of C5a convertase
Bioactivity
Testing in progress
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
678-751 aa
Sequence
GTLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR​
Accession #
Predicted molecular weight
8.3 kDa
SDS-PAGE
10.0 kDa; under reducing conditions
Molecule Type
Protein
Storage and Shipping
Concentration
expressed in E. coli; See COA
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃ for 12 months. Upon reconstitution; it is recommended to aliquot. Avoid freeze/thaw cycle.
Images
Recombinant Human Complement Component C5a Protein (rp169563) - SDS-PAGE 
3 μg/lane of Recombinant Human Complement Component C5a Protein was resolved with SDS-PAGE under reducing (R) conditions and visualized by Coomassie® Blue staining, showing the bands at 10.0 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ26F0434757Certificate of AnalysisApr 29, 2026 rp169563
ZJ26F0434756Certificate of AnalysisApr 29, 2026 rp169563
ZJ26F0434755Certificate of AnalysisApr 29, 2026 rp169563
Solution Calculators
Reviews

Customer Reviews

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.