Recombinant Human FGF-23 Protein

Cat. No.: rp222570
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE) expressed in HEK293; See COA
Accession #
Q9GZV9
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured in a cell proliferation assay using NIH‑3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 35.4 ng/mL in the presence of Recombinant Mouse Klotho beta.
Size
Status
Price
Qty
10μg
rp222570-10μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$139.90
50μg
rp222570-50μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$399.90
100μg
rp222570-100μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$629.90
1mg
rp222570-1mg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$3,299.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,His Tag,≥95%(SDS-PAGE),expressed in HEK293; See COA ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human FGF-23 Protein
Synonyms
Fibroblast Growth Factor 23 | FGF23 | HYPF | FGF-23 | ADHR | HPDR2 | UNQ3027/PRO9828 | Phosphatonin | Tumor-derived hypophosphatemia-inducing factor
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, His Tag
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, His Tag, ≥95%(SDS-PAGE), expressed in HEK293; See COA
Biochemical and Physiological Mechanisms
Fibroblast growth factor 23 (FGF‑23) is a 30‑32 kDa member of the FGF family, within a subfamily that also includes FGF‑19 and FGF‑21. FGF proteins contain a 120 amino acid (aa) core FGF domain that exhibits a beta ‑trefoil structure. FGF‑19 subfamily mem
Bioactivity
Measured in a cell proliferation assay using NIH‑3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 35.4 ng/mL in the presence of Recombinant Mouse Klotho beta.
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
1-251 aa (R179Q)
Sequence
MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFIHHHHHH
Accession #
Predicted molecular weight
26.1 kDa
SDS-PAGE
27.2-34.0 kDa; under reducing conditions; 26.3-32.7 kDa; under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Concentration
expressed in HEK293; See COA
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃ for 6 months. Upon receipt; it is recommended to aliquot. Avoid freeze/thaw cycle.
Images
Recombinant Human FGF23 Protein (rp222570) - Protein Bioactivity 
Measured in a cell proliferation assay using NIH‑3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 35.4 ng/mL in the presence of Recombinant Mouse Klotho beta.
Recombinant Human FGF23 Protein (rp222570) - SDS-PAGE 
3 μg/lane of Recombinant Human FGF23 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 27.2-34.0 kDa under reducing conditions and 26.3-32.7 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.