Recombinant Human Flt-3 Ligand/FLT3L GMP Protein

Cat. No.: rp163960-GMP
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. ≥97%(SDS-PAGE&SEC-HPLC)
Expression System
E. coli
Accession #
P49771
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Measured in a cell proliferation assay using OCI-AML5 acute myeloid leukemia cells. The ED50 for this effect is 0.200-2.00 ng/mL. The specific activity of Recombinant Human Flt-3 Ligand/FLT3L is >5.00 x 10^5 units/mg, which is calibrated against the human Flt-3 Ligand WHO standard (NIBSC code: 96/532).
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
50μg
rp163960-GMP-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.

$974.90

$1,279.90
Save $305.00 (23.83%)
1mg
rp163960-GMP-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$10,239.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,≥97%(SDS-PAGE&SEC-HPLC) ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human Flt-3 Ligand/FLT3L GMP Protein
Synonyms
fms-like Tyrosine Kinase 3 Ligand | FL | FLG3L | Flt3 ligand | Flt-3 Ligand | Flt3L | FLT3LG | fms-related tyrosine kinase 3 ligand | SL cytokine | IMD125
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, ≥97%(SDS-PAGE&SEC-HPLC)
Biochemical and Physiological Mechanisms
Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins.
Bioactivity
Measured in a cell proliferation assay using OCI-AML5 acute myeloid leukemia cells. The ED50 for this effect is 0.200-2.00 ng/mL. The specific activity of Recombinant Human Flt-3 Ligand/FLT3L is >5.00 x 10^5 units/mg, which is calibrated against the human Flt-3 Ligand WHO standard (NIBSC code: 96/532).
Endotoxin Concentration
<0.1 EU/μg
Expression System
E. coli
Amino Acids
27-181 aa
Sequence
MTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA
Protein Tag
No tag
N-terminal Sequence
Met-Thr27-Gln-Asp-(Cys)-Ser-Phe-Gln-His-Ser & Thr27-Gln-Asp-(Cys)-Ser-Phe-Gln-His-Ser-Pro
Accession #
Predicted molecular weight
18 kDa
SDS-PAGE
17 kDa under reducing conditions.
Molecule Type
Protein
Storage and Shipping
Reconstitution
Reconstitute at 500 μg/mL in PBS.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
A minimum of 12 months when stored at ≤ -20 ℃ as supplied. 1 month, 2 to 8 ℃ under sterile conditions after reconstitution. 3 months, ≤ -20 ℃ under sterile conditions after reconstitution. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycl

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.