Recombinant Human IL-6 GMP Protein

Cat. No.: rp168383-GMP
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥97%(SDS-PAGE&SEC-HPLC)
Expression System
E. coli
Accession #
P05231.1
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Measured in a cell proliferation assay using T1165.85.2.1 mouse plasmacytoma cells. The ED50 for this effect is 0.2‑0.8 ng/mL. The specific activity of Recombinant Human IL-6 is >1.0 x 10^8 IU/mg, which is calibrated against the human IL‑6 WHO International Standard(NIBSC code: 89/548).
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
50μg
rp168383-GMP-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$1,079.90
1mg
rp168383-GMP-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.

$6,079.90

$8,639.90
Save $2,560.00 (29.63%)
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,PBS Only,≥97%(SDS-PAGE&SEC-HPLC) ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human IL-6 GMP Protein
Synonyms
B-cell differentiation factor | B-cell stimulatory factor 2 | BSF2 | BSF-2 | CDF | CTL differentiation factor | HSF | hybridoma growth factor | IFNB2 | IFN-beta-2 | IL6 | IL-6 | Interferon beta-2 | HGF | interleukin 6 (interferon, beta 2) | interleukin BS
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, PBS Only
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, PBS Only, ≥97%(SDS-PAGE&SEC-HPLC)
Biochemical and Physiological Mechanisms
Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. It induc
Bioactivity
Measured in a cell proliferation assay using T1165.85.2.1 mouse plasmacytoma cells. The ED50 for this effect is 0.2‑0.8 ng/mL. The specific activity of Recombinant Human IL-6 is >1.0 x 10^8 IU/mg, which is calibrated against the human IL‑6 WHO International Standard(NIBSC code: 89/548).
Endotoxin Concentration
<0.1 EU/μg
Expression System
E. coli
Amino Acids
29-212 aa
Sequence
PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Protein Tag
No tag
N-terminal Sequence
Pro29-Val-Pro-Pro-Gly-Glu-Asp-Ser-Lys-Asp
Accession #
Predicted molecular weight
20.9 kDa
SDS-PAGE
20-21 kDa, under reducing conditions
Molecule Type
Protein
Storage and Shipping
Reconstitution
Reconstitute at 100-200 μg/mL in sterile PBS.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
A minimum of 12 months when stored at ≤ -20 ℃ as supplied. 1 month, 2 to 8 ℃ under sterile conditions after reconstitution. 3 months, ≤ -20 ℃ under sterile conditions after reconstitution. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycl

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.