Recombinant Human KGF/FGF-7 GMP Protein

Cat. No.: rp168336-GMP
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥97%(SDS-PAGE&SEC-HPLC)
Expression System
E. coli
Accession #
P21781.1
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Measured in a cell proliferation assay using 4MBr5 rhesus monkey epithelial cells.The ED50 for this effect is 6-60 ng/mL. The specific activity of recombinant human KGF/FGF-7 is >8.16 x 10^5 units/mg, which is calibrated against the human KGF/FGF-7 WHO Standard (NIBSC code: 03/150).
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
50μg
rp168336-GMP-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$1,269.90
1mg
rp168336-GMP-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$10,159.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,PBS Only,≥97%(SDS-PAGE&SEC-HPLC) ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human KGF/FGF-7 GMP Protein
Synonyms
FGF7 | FGF-7 | fibroblast growth factor 7HBGF-7 | HBGF7 | HBGF-7 | Heparin-binding growth factor 7 | keratinocyte growth factor | KGF | KGFfibroblast growth factor 7 (keratinocyte growth factor)
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, PBS Only
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, PBS Only, ≥97%(SDS-PAGE&SEC-HPLC)
Biochemical and Physiological Mechanisms
Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. Growth factor active on keratinocytes. Possible major paracrine effector of normal epithelial cel
Bioactivity
Measured in a cell proliferation assay using 4MBr5 rhesus monkey epithelial cells.The ED50 for this effect is 6-60 ng/mL. The specific activity of recombinant human KGF/FGF-7 is >8.16 x 10^5 units/mg, which is calibrated against the human KGF/FGF-7 WHO Standard (NIBSC code: 03/150).
Endotoxin Concentration
<0.1 EU/μg
Expression System
E. coli
Amino Acids
32-194 aa
Sequence
MCNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
Protein Tag
No tag
N-terminal Sequence
Met-(Cys)32-Asn-Asp-Met-Thr-Pro-Glu-Gln-Met (Cys)32-Asn-Asp-Met-Thr-Pro-Glu-Gln-Met-Ala
Accession #
Predicted molecular weight
19 kDa
SDS-PAGE
20 kDa, under reducing conditions
Molecule Type
Protein
Storage and Shipping
Reconstitution
Reconstitute at 100 μg/mL in PBS.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
A minimum of 12 months when stored at ≤ -20 ℃ as supplied. 1 month, 2 to 8 ℃ under sterile conditions after reconstitution. 3 months, ≤ -20 ℃ under sterile conditions after reconstitution. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycl

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.