Recombinant Human LEFTY2 Protein

Cat. No.: rp222591
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥90%(SDS-PAGE) expressed in HEK293; See COA
Accession #
O00292
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human LEFTY2 Protein (rp222591) at 1.0 μg/mL can bind Recombinant LEFTY1/LEFTY2 Antibody (Ab112968) with the EC50 of 6.7 ng/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp222591-10μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$39.90
50μg
rp222591-50μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$119.90
100μg
rp222591-100μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$189.90
1mg
rp222591-1mg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$1,129.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,His Tag,≥90%(SDS-PAGE),expressed in HEK293; See COA ActiBioPure™,Animal Free,Bioactive,Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human LEFTY2 Protein
Synonyms
EBAF | LEFTA | LEFTYA | TGFB4 | PSEC0024 | LEFTY2 | Left-right determination factor 2 | Endometrial bleeding-associated factor | Left-right determination factor A | Protein lefty-2 | Protein lefty-A | Transforming growth factor beta-4 | TGF-beta-4
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, His Tag
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, His Tag, ≥90%(SDS-PAGE), expressed in HEK293; See COA
Biochemical and Physiological Mechanisms
LEFTY2 functions as an important regulator in ensuring proper left-right asymmetry during embryonic development. It is a monomeric protein that is not part of a larger complex. LEFTY2 contributes to the modulation of Nodal signaling inhibiting excessive a
Bioactivity
Immobilized Recombinant Human LEFTY2 Protein (rp222591) at 1.0 μg/mL can bind Recombinant LEFTY1/LEFTY2 Antibody (Ab112968) with the EC50 of 6.7 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
78-366aa
Sequence
MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEKLVIPAHVRAQYVVLLRRSHGDRSRGKRHHHHHHFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP
Accession #
Predicted molecular weight
39.4 kDa
SDS-PAGE
43.4 kDa, under reducing conditions; 39.4 kDa, under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Concentration
expressed in HEK293; See COA
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃ for 12 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images
Recombinant Human LEFTY2 Protein (rp222591) - ELISA
Immobilized Recombinant Human LEFTY2 Protein (rp222591) at 1.0 μg/mL can bind Recombinant LEFTY1/LEFTY2 Antibody (Ab112968) with the EC₅₀ of 6.7 ng/mL.
Recombinant Human LEFTY2 Protein (rp222591) - SDS-PAGE 
3 μg/lane of Recombinant Human LEFTY2 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 43.4 kDa under reducing conditions and 39.4 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.