Recombinant Human MUC-1 Protein

Cat. No.: rp169648
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Fc tag ? Fc tag grade — recombinant protein bearing a Fc tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. The Fc tag aids dimerization and protein-A/G capture. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥90%(SDS-PAGE)
Expression System
HEK293
Accession #
P15941
Protein Tag
C-Fc
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human MUC1 Protein (rp169648) at 1.0 μg/mL can bind MUC1 Mouse mAb (Ab116370) with the EC50 of 16.6 ng/mL. Immobilized Recombinant Human MUC1 Protein (rp169648) at 1.0 μg/mL can bind MUC1/CD227 Mouse mAb (Ab116379) with the EC50 of 28.33 ng/mL.
Size
Status
Price
Qty
10μg
rp169648-10μg
≥10
$149.90
50μg
rp169648-50μg
7
$449.90
100μg
rp169648-100μg
7
$719.90
1mg
rp169648-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$3,599.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Fc tag,PBS Only,≥90%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,Fc tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human MUC-1 Protein
Synonyms
Breast carcinoma-associated antigen DF3 | Carcinoma-associated mucin | CD227 antigen | CD227 | DF3 antigen | EMA | Episialin | H23 antigen | H23AG | KL-6 | MAM6 | MUC-1 | MUC1/ZD | mucin 1, cell surface associated | mucin 1, transmembrane | Mucin-1 | Pean
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, Fc tag, PBS Only
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, Fc tag, PBS Only, ≥90%(SDS-PAGE)
Biochemical and Physiological Mechanisms
Mucin 1, cell surface-associated (MUC1) or polymorphic epithelial mucin (PEM) is a membrane-bound protein that is a member of the mucin family. Mucins are O-glycosylated proteins that play an essential role in forming protective mucous barriers on epithel
Bioactivity
Immobilized Recombinant Human MUC1 Protein (rp169648) at 1.0 μg/mL can bind MUC1 Mouse mAb (Ab116370) with the EC50 of 16.6 ng/mL. Immobilized Recombinant Human MUC1 Protein (rp169648) at 1.0 μg/mL can bind MUC1/CD227 Mouse mAb (Ab116379) with the EC50 of 28.33 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Expression System
HEK293
Amino Acids
1-167 aa
Sequence
MTPGTQSPFFLLLLLTVLTATTAPKPATVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNAFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGLEVLFQGPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Protein Tag
C-Fc
Accession #
Predicted molecular weight
44.6 kDa
SDS-PAGE
48.9-67.6 kDa, under reducing conditions; 48.9-67.6 &100.8-145.8 kDa, under non-reducing conditions
Molecule Type
Protein
Storage and Shipping
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Images

Recombinant Human MUC-1 Protein (rp169648) - ELISA
Immobilized Recombinant Human MUC-1 Protein (rp169648) at 1.0 μg/mL can bind MUC1 Mouse mAb (Ab116370) with the EC50 of 16.6 ng/mL.

Recombinant Human MUC-1 Protein (rp169648) - ELISA
Immobilized Recombinant Human MUC-1 Protein (rp169648) at 1.0 μg/mL can bind MUC1/CD227 Mouse mAb (Ab116379) with the EC50 of 28.33 ng/mL.

Recombinant Human MUC-1 Protein (rp169648) - SDS-PAGE
3 μg/lane of Recombinant Human MUC-1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 48.9-67.6 kDa under reducing conditions and 48.9-67.6 &100.8-145.8 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ24F1011656Certificate of AnalysisMay 21, 2026 rp169648
ZJ24F1011657Certificate of AnalysisMay 21, 2026 rp169648
ZJ24F1011658Certificate of AnalysisMay 21, 2026 rp169648
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.