Recombinant Human NMDAR1 Protein

Cat. No.: rp217158
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. SUMO tag ? SUMO tag grade — recombinant protein bearing a SUMO tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. SUMO can boost expression and solubility. ≥90%(SDS-PAGE) expressed in E. coli; See COA
Accession #
Q05586
Protein Tag
N-6His & Sumo
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp217158-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$139.90
50μg
rp217158-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$399.90
100μg
rp217158-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$599.90
1mg
rp217158-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$3,599.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,SUMO tag,≥90%(SDS-PAGE),expressed in E. coli; See COA Carrier Free,SUMO tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human NMDAR1 Protein
Synonyms
glutamate [NMDA] receptor subunit zeta-1glutamate receptor, ionotropic, N-methyl D-aspartate 1 | NMDA1 | NMDAR1glutamate [NMDA] receptor subunit zeta 1 | NMD-R1 | N-methyl-D-aspartate receptor channel, subunit zeta-1 | N-methyl-D-aspartate receptor subuni
Grade
Carrier Free, SUMO tag
Specifications & Purity
Carrier Free, SUMO tag, ≥90%(SDS-PAGE), expressed in E. coli; See COA
Biochemical and Physiological Mechanisms
Component of N-methyl-D-aspartate (NMDA) receptors (NMDARs) that function as heterotetrameric, ligand-gated cation channels with high calcium permeability and voltage-dependent block by Mg2+ (PubMed:21376300, PubMed:26875626, PubMed:26919761, PubMed:28126
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
167-280 aa
Sequence
MGSSHHHHHHSSGLVPRGSHMASMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG VSDDHEGRAAQKRLETLLEERESKAEKVLQFDPGTKNVTALLMEAKELEARVIILSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGILGLQLINGKNESAH
Accession #
Predicted molecular weight
26.1 kDa
SDS-PAGE
28.4 kDa, under reducing conditions; 28.4 kDa, under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Concentration
expressed in E. coli; See COA
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃ for 12 months. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images
Recombinant Human NMDAR1 Protein (rp217158) - SDS-PAGE 
3 μg/lane of Recombinant Human NMDAR1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 28.4 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ26F0434675Certificate of AnalysisApr 24, 2026 rp217158
ZJ26F0434674Certificate of AnalysisApr 24, 2026 rp217158
ZJ26F0434673Certificate of AnalysisApr 24, 2026 rp217158
Solution Calculators
Reviews

Customer Reviews

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide → View SUMO tag grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.