Recombinant Human SEC22B Protein

Cat. No.: rp192234
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥90%(SDS-PAGE) expressed in E. coli, See COA
Accession #
O75396
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp192234-10μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$89.90
50μg
rp192234-50μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$249.90
100μg
rp192234-100μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$399.90
1mg
rp192234-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$2,599.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,His Tag,≥90%(SDS-PAGE),expressed in E. coli, See COA Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human SEC22B Protein
Synonyms
SEC22 Vesicle Trafficking Protein Homolog B (S. Cerevisiae) Gene/Pseudogene | SEC22 Vesicle Trafficking Protein-Like 1 (S. Cerevisiae) | ER-Golgi SNARE Of 24 KDa | SEC22L1 | ERS-24 | SEC22B | Vesicle-trafficking protein SEC22b | SEC22 vesicle-trafficking
Grade
Carrier Free, His Tag
Specifications & Purity
Carrier Free, His Tag, ≥90%(SDS-PAGE), expressed in E. coli, See COA
Biochemical and Physiological Mechanisms
SEC22B contributes to the fusion of transport vesicles with target membranes. It acts as part of a SNARE complex facilitating vesicle docking and subsequent membrane fusion through protein-protein interaction. In immune cells SEC22B is essential for antig
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
14-194 aa
Sequence
MHHHHHHLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKYRQDAKYLNMRSTYA
Accession #
Predicted molecular weight
21.8 kDa
SDS-PAGE
21.2 kDa, under reducing conditions.
Molecule Type
Protein
Storage and Shipping
Concentration
expressed in E. coli, See COA
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃ long term (12 months). Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images
Recombinant Human SEC22B Protein (rp192234) - SDS-PAGE 
3 μg/lane of Recombinant Human SEC22B Protein was resolved with SDS-PAGE under reducing (R) and visualized by Coomassie® Blue staining, showing the band at 21.2 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ26F0434580Certificate of AnalysisApr 23, 2026 rp192234
ZJ26F0434581Certificate of AnalysisApr 23, 2026 rp192234
ZJ26F0434582Certificate of AnalysisApr 23, 2026 rp192234
Solution Calculators
Reviews

Customer Reviews

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide → View His Tag grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.