Recombinant Human Sonic Hedgehog Protein

Cat. No.: rp228981
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE) See COA
Accession #
Q15465
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human Sonic Hedgehog N-Terminus Protein (rp228981) at 1.0 μg/mL can bind Sonic Hedgehog Mouse mAb (Ab128686) with the EC50 of 17.3 ng/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp228981-10μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$89.90
50μg
rp228981-50μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$269.90
100μg
rp228981-100μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$429.90
1mg
rp228981-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$2,599.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,PBS Only,≥95%(SDS-PAGE),See COA Animal Free,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human Sonic Hedgehog Protein
Synonyms
HHG1 | HHG-1 | HLP3 | HPE3 | MCOPCB5 | MCOPCB5sonic hedgehog (Drosophila) homolog | Shh | ShhNC | SMMCI | SMMCIsonic hedgehog homolog (Drosophila) | sonic hedgehog homolog | sonic hedgehog protein | Sonic Hedgehog | TPT | TPTPS
Grade
Animal Free, PBS Only
Specifications & Purity
Animal Free, PBS Only, ≥95%(SDS-PAGE), See COA
Biochemical and Physiological Mechanisms
Binds to the patched (PTC) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes. In the absence of SHH, PTC represses the constitutive signaling activity of SMO. Also regulates another target, the g
Bioactivity
Immobilized Recombinant Human Sonic Hedgehog N-Terminus Protein (rp228981) at 1.0 μg/mL can bind Sonic Hedgehog Mouse mAb (Ab128686) with the EC50 of 17.3 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
24-197 aa
Sequence
SCGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
Accession #
Predicted molecular weight
19.6 kDa
SDS-PAGE
17.6-22.7 & 40.1-44.1 kDa, reducing conditions; 17.8-23.5 & 36.6-45.6 & 58.8-66.3 kDa, non-reducing conditions
Molecule Type
Protein
Storage and Shipping
Concentration
See COA
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃ for 12 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle
Images
Recombinant Human Sonic Hedgehog Protein (rp228981) - ELISA
 Immobilized Recombinant Human Sonic Hedgehog Protein (rp228981) at 1.0 μg/mL can bind Sonic Hedgehog Mouse mAb (Ab128686) with the EC50 of 17.3 ng/mL.
Recombinant Human Sonic Hedgehog Protein (rp228981) - SDS-PAGE 
3 μg/lane of Recombinant Human Sonic Hedgehog Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 17.6-22.7 & 40.1-44.1 kDa under reducing conditions and 17.8-23.5 & 36.6-45.6 & 58.8-66.3 kDa under non-reducing conditions. Sonic Hedgehog can form Multimer. Multiple bands correspond to multiple conformations, which caused by incomplete autocleavage in animal-component-free medium (Uniprot: Q15465).

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ26F0333617Certificate of AnalysisApr 01, 2026 rp228981
ZJ26F0333616Certificate of AnalysisApr 01, 2026 rp228981
ZJ26F0333615Certificate of AnalysisApr 01, 2026 rp228981
Solution Calculators
Reviews

Customer Reviews

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Animal Free grade guide → View PBS Only grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.