Recombinant Porcine IL-8/CXCL8 Protein

Cat. No.: rp186593

GRADE & PURITY Carrier Free, PBS Only, ≥95%(SDS-PAGE)

Accession #

P26894

Protein Tag

No tag

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Testing in progress

Specifications

Product Name

Recombinant Porcine IL-8/CXCL8 Protein

Synonyms

3-10C | AMCF-I | C-X-C motif chemokine 8 | CXCL8 | CXCL8SCYB8 | Emoctakin | GCP1 | GCP-1TSG-1 | IL8 | IL-8 | interleukin 8 | K60 | LAI | LECT | LUCT | LYNAP | MDNCF | MDNCFb-ENAP | member 8 | MONAP | MONAPGCP1 | NAF | NAP1 | NAP-1NAP1 | Neutrophil-activat

Grade

Carrier Free, PBS Only

Specifications & Purity

Carrier Free, PBS Only, ≥95%(SDS-PAGE)

Biochemical and Physiological Mechanisms

IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold hig

Bioactivity

Testing in progress

Endotoxin Concentration

<1.0 EU/μg

Amino Acids

26-103 aa

Sequence

ARVSAELRCQCINTHSTPFHPKFIKELRVIESGPHCENSEIIVKLVNGKEVCLDPKEKWVQKVVQIFLKRTEKQQQQQ​

Accession #

P26894

Predicted molecular weight

9.0 kDa

SDS-PAGE

11.5 kDa, under reducing conditions; 13.0 & 17.9 kDa, under non-reducing conditions

Molecule Type

Protein

Storage and Shipping

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Storage

Store at -20°C,Avoid repeated freezing and thawing

Shipped In

Ice chest + Ice pads

Stability And Storage

Store at -20°C for 1 year. Avoid freeze/thaw cycle.

Images

SDS-PAGE: Recombinant Porcine IL-8/CXCL8 Protein (rp186593)

Recombinant Porcine IL-8 /CXCL8 Protein (rp186593) - SDS-PAGE
3 μg/lane of Recombinant Porcine IL-8 /CXCL8 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 11.5 kDa under reducing conditions and 13.0 & 17.9 kDa under non-reducing conditions.