Psalmotoxin 1 TFA, CAS No.316808-68-1 (free base)

CAS: 316808-68-1 (free base) Cat. No.: P1417450 Molecular Weight: 4689.39 (free base)
AVAILABLE TO ORDER
GRADE & PURITY BioReagent ? BioReagent grade — tested suitable for life-science and molecular-biology use. Use for cell culture, assays, and biochemical work needing biological compatibility. ≥95%(HPLC)
Accession #
P60514
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
100μg
P1417450-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$279.90
500μg
P1417450-500μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$839.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

BioReagent,≥95%(HPLC) BioReagent for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Protected from light,Store at -20°C,Desiccated,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Psalmotoxin 1 (PcTx1) TFA  is a protein toxin that can bind at subunit-subunit interfaces of acid-sensing ion channel 1a (ASIC1a). Psalmotoxin 1 is a potent and selective ASIC1a inhibitor (IC₅₀: 0.9 nM) by increasing the apparent affinity for H⁺ of ASIC1a. Psalmotoxin 1 can induce cell apoptosis, also inhibits cell migration, proliferation and invasion of cancer cells. Psalmotoxin 1 can be used in the research of cancers, or neurological disease.
Sequence: Glu-Asp-Cys-Ile-Pro-Lys-Trp-Lys-Gly-Cys-Val-Asn-Arg-His-Gly-Asp-Cys-Cys-Glu-Gly-Leu-Glu-Cys-Trp-Lys-Arg-Arg-Arg-Ser-Phe-Glu-Val-Cys-Val-Pro-Lys-Thr-Pro-Lys-Thr (Disulfide bridge: Cys3-Cys18, Cys10-Cys23, Cys17-Cys33)
Formula:  C₂₀₀H₃₁₂N₆₂O₅₇S₆・xC₂HF₃O₂ 
Molecular weight: 4689.41(free base) 

Specifications

Product Name
Psalmotoxin 1 TFA, CAS No.316808-68-1 (free base)
Synonyms
PcTx1 | Psalmopoeus cambridgei toxin-1 | Psalmotoxin 1
Grade
BioReagent
Specifications & Purity
BioReagent, ≥95%(HPLC)
Biochemical and Physiological Mechanisms
This toxin is a gating modifier that acts principally as an inhibitor on ASIC1a (ASIC isoform 2) and a potentiator on ASIC1b (ASIC isoform 3). This toxin potently and selectively inhibits rat, mouse and human ASIC1a (IC50=0.35-3.7 nM). The blockade is rap
Amino Acids
1-40 aa
Sequence
EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT
Accession #
Predicted molecular weight
4689.41(free base)
CAS
316808-68-1 (free base)
Molecule Type
Peptide
Storage and Shipping
Reconstitution
Reconstitute in water.
Storage
Protected from light,Store at -20°C,Desiccated,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃ long term (24 months). Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle. Store in the dark. Desiccated.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

1 results found

Lot NumberCertificate TypeDateItem
ZJ26F0332644Certificate of AnalysisMar 11, 2026 P1417450
Solution Calculators
Reviews

Customer Reviews

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View BioReagent grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.