Recombinant Feline CD14 Protein

Cat. No.: rp175912
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
M3VWC6
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp175912-10μg
≥10
$95.90
100μg
rp175912-100μg
≥10
$367.90
1mg
rp175912-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$2,599.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Azide Free,His Tag,PBS Only,≥95%(SDS-PAGE) Animal Free,Azide Free,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description:
CD14 is a 55 kDa cell surface glycoprotein that is preferentially expressed on monocytes/macrophages. The mouse CD14 cDNA encodes a 366 amino acid (aa) residue precursor protein with a 15 aa signal peptide and a C-terminal hydrophobic region characteristic for glycosylphosphatidyinositol (GPI)-anchored proteins. Mouse CD14 has five potential N-linked glycosylation sites and also bears O-linked carbohydrates. The amino acid sequence of mouse CD14 is approximately 65% and 82% identical to the human and rat proteins, respectively. CD14 is a pattern recognition receptor that binds lipopolysaccharides (LPS) and a variety of ligands derived from different microbial sources. The binding of CD14 with LPS is catalyzed by LPS-binding protein (LBP). The toll-like-receptors have also been implicated in the transduction of CD14-LPS signals. Similar to other GPI-anchored proteins, soluble CD14 can be released from the cell surface by phosphatidyinositol-specific phospholipase C. Soluble CD14 has been detected in serum and body fluids. High concentrations of soluble CD14 have been shown to inhibit LPS-mediated responses. However, soluble CD14 can also potentiate LPS response in cells that do not express cell surface CD14.

Specifications

Product Name
Recombinant Feline CD14 Protein
Synonyms
CD14 molecule | CD14 antigen | LPS-R | Mo2 | Monocyte differentiation antigen CD14 | Monocyte differentiation antigen CD14 urinary form | Monocyte differentiation antigen CD14 membrane-bound form | Myeloid cell specific leucine rich glycoprotein | Myeloid
Grade
Animal Free, Azide Free, Carrier Free, His Tag, PBS Only
Specifications & Purity
Animal Free, Carrier Free, Azide Free, His Tag, PBS Only, ≥95%(SDS-PAGE)
Endotoxin Concentration
<1.0 EU/μg
Expression System
HEK293
Amino Acids
22-375 aa
Sequence
ETTPEPCEVDDDDVRCFCNFTDPQPDWSSAFQCMAAVEVEIHGGGRSLEQFLKGADADPKQYADMVKALRLRRLTVGSAQVPAVLLVAFLRALSYSRLKELTLQNLEVTGAMPPLLLEATGPALSTLSLRNVSWATGGAWLAELQQWLKPGLKVLNIAQAHSLAFPCSQLRTFPALTTLDLSDNPGLGEDGLTAALCPHKFPALRALALRNAGMETPNGVCVAMAAAGVQPHSLDLSHNSLRATAPGAPGCVWPSTLNSLNLSFAGLEQVPKGLPAKLSVLDLRCNRLNRVPGLEELPKVSNLTLDGNPFMDPEAPKYQEDPMNSGVVQACARSALAVGMSGTLAVLQRAGGFAHHHHHH
Protein Tag
C-His
Accession #
Predicted molecular weight
38.4 kDa
SDS-PAGE
44.0-54.0 kDa, under reducing conditions.
Molecule Type
Protein
Storage and Shipping
Shape
Lyophilized
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃ stable up to 1 year. Avoid freeze / thaw cycle.
Images

Recombinant Feline CD14 Protein (rp175912) - SDS-PAGE
3 μg/lane of Recombinant Feline CD14 Protein (rp175912) was resolved with SDS-PAGE under reducing (R) and visualized by Coomassie® Blue staining, showing a band at 44.0-54.0 kDa under reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeDateItem
ZJ24F0303057Certificate of AnalysisJul 13, 2026 rp175912
ZJ24F0303058Certificate of AnalysisJul 13, 2026 rp175912
ZJ24F0303059Certificate of AnalysisJul 13, 2026 rp175912
ZJ24R0200297Certificate of AnalysisFeb 29, 2024 rp175912
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.