Recombinant Human Betacellulin Protein

Cat. No.: rp302768
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Accession #
P35070
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.15 ng/mL.
Size
Status
Price
Qty
10μg
rp302768-10μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$89.90
50μg
rp302768-50μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$269.90
100μg
rp302768-100μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$429.90
1mg
rp302768-1mg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$2,599.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,PBS Only,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human Betacellulin Protein
Synonyms
Betacellulin | Betacellulin precursor | BTC | BTC_HUMAN | OTTHUMP00000160600 | OTTHUMP00000219057 | Probetacellulin
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, PBS Only
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, PBS Only, ≥95%(SDS-PAGE)
Biochemical and Physiological Mechanisms
Betacellulin(BTC) is a member of the epidermal growth factor (EGF) family. These soluble proteins are ligands for one or more of the four receptor tyrosine kinases encoded by the ErbB gene family (ErbB-1/epidermal growth factor receptor (EGFR), neu/ErbB-2
Bioactivity
Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.15 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
32-118 aa
Sequence
GDGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQ
Accession #
Predicted molecular weight
9.8 kDa
SDS-PAGE
15.6 kDa, under reducing conditions; 15.8 kDa, under non-reducing conditions
Molecule Type
Protein
Storage and Shipping
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃ for 6 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images
Recombinant Human Betacellulin Protein (rp302768) - Protein Bioactivity 
Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED₅₀ for this effect is 0.15 ng/mL.
Recombinant Human Betacellulin Protein (rp302768) - SDS-PAGE 
3 μg/lane of Recombinant Human Betacellulin Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 15.6 kDa under reducing conditions and 15.8 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.