Recombinant Human COX IV Protein, >90% (SDS-PAGE)

Cat. No.: rp176694
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. MBP tag ? MBP tag grade — recombinant protein bearing a MBP tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. MBP also improves solubility. ≥90%(SDS-PAGE)
Expression System
E. coli
Accession #
P13073
Protein Tag
N-His & MBP
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human COX IV Protein (rp176694) at 1.0 μg/mL can bind COX IV Mouse mAb (Ab181868) with the EC50 of 74.4 ng/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp176694-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$139.90
100μg
rp176694-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$599.90
1mg
rp176694-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$2,999.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Bioactive,ActiBioPure™,His Tag,MBP tag,≥90%(SDS-PAGE) ActiBioPure™,Bioactive,Carrier Free,His Tag,MBP tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Purity:>90%, by SDS-PAGE visualized with Coomassie® Blue Staining.
This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.

Specifications

Product Name
Recombinant Human COX IV Protein, >90% (SDS-PAGE)
Synonyms
Cytochrome c oxidase subunit 4 isoform 1, mitochondrial | Cytochrome c oxidase subunit 4 isoform 1 mitochondrial | Cytochrome C Oxidase subunit IV | Cytochrome c oxidase polypeptide IV | Cytochrome c oxidase subunit IV isoform 1 (COX IV-1) | Cytochrome c
Grade
ActiBioPure™, Bioactive, Carrier Free, His Tag, MBP tag
Specifications & Purity
Carrier Free, Bioactive, ActiBioPure™, His Tag, MBP tag, ≥90%(SDS-PAGE)
Purity
>90% (SDS-PAGE)
Bioactivity
Immobilized Recombinant Human COX IV Protein (rp176694) at 1.0 μg/mL can bind COX IV Mouse mAb (Ab181868) with the EC50 of 74.4 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Expression System
E. coli
Amino Acids
1-98 aa
Sequence
MGSSHHHHHHGSSMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKGIEENLYFQSMLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSN
Protein Tag
N-His & MBP
Accession #
Predicted molecular weight
55.7 kDa
SDS-PAGE
56.5 kDa, under reducing conditions; 56.5 & 125.2 kDa, under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Shape
Liquid
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle.
Images
Recombinant Human COX IV protein (rp176694) - ELISA 
Immobilized Recombinant Human COX IV Protein (rp176694) at 1.0 μg/mL can bind COX IV Mouse mAb (Ab181868) with the EC₅₀ of 74.4 ng/mL.
Recombinant Human COX IV protein (rp176694) - SDS-PAGE 
2 μg/lane of Recombinant Human COX IV protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 56.5 kDa under reducing conditions and 56.5 & 125.2 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.