Recombinant Human LR3 IGF-I/IGF-1 Protein

Cat. No.: rp166305
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. Sterile ? Sterile grade — processed and verified free of viable microorganisms. Use directly in aseptic procedures and cell culture without further sterilization. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥98%(SDS-PAGE&HPLC)
Accession #
P05019
Protein Tag
C-His
Expression system
E. coli
Endotoxin Concentration
<0.01 EU/μg
Bioactivity
Measured in a cell proliferation assay using human MCF7 cells. The ED50 for this effect is < 5 ng/mL. The corresponding specific activity is>2×10^5 IU/mg.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
50μg
rp166305-50μg
3
$99.90
100μg
rp166305-100μg
2
$149.90
1mg
rp166305-1mg
1

$571.90

$899.90
Save $328.00 (36.45%)
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,sterile,His Tag,PBS Only,≥98%(SDS-PAGE&HPLC) ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,His Tag,PBS Only,Sterile for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human LR3 IGF-I/IGF-1 Protein
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, His Tag, PBS Only, Sterile
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, sterile, His Tag, PBS Only, ≥98%(SDS-PAGE&HPLC)
Biochemical and Physiological Mechanisms
The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthe
Bioactivity
Measured in a cell proliferation assay using human MCF7 cells. The ED50 for this effect is < 5 ng/mL. The corresponding specific activity is>2×10^5 IU/mg.
Endotoxin Concentration
<0.01 EU/μg
Amino Acids
49-118 aa (E51R)
Sequence
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSAHHHHHH
Accession #
Predicted molecular weight
9.1 kDa
SDS-PAGE
9.1 kDa
Molecule Type
Protein
Storage and Shipping
Reconstitution
Reconstitute in water to a concentration of 1 mg/mL, for other concentrations, please adjust the concentration of phosphate in the solution by yourself.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃~-80℃ long term (60 months). Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images

Recombinant Human LR3 IGF-I/IGF-1 Protein (rp166305) - SDS-PAGE
2 μg/lane of Recombinant Human LR3 IGF-I/IGF-1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 10 kDa.

Recombinant Human LR3 IGF-I/IGF-1 Protein (rp166305) - Protein Bioactivity
Measured in a cell proliferation assay using human MCF7 cells. The ED50 for this effect is < 5 ng/mL. The corresponding specific activity is>2×10^5 IU/mg.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.