Recombinant Rat PDGF-BB Protein

Cat. No.: rp186540
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE) See COA
Accession #
Q05028
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.78 ng/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp186540-10μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$119.90
50μg
rp186540-50μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$329.90
100μg
rp186540-100μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$529.90
1mg
rp186540-1mg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$3,329.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Bioactive,ActiBioPure™,PBS Only,≥95%(SDS-PAGE),See COA ActiBioPure™,Bioactive,Carrier Free,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Rat PDGF-BB Protein
Synonyms
c-sis | IBGC5 | PDGF2 | PDGF-2 | PDGFB | Platelet-derived growth factor subunit B | SIS | SSV | PDGFBB | PDGF-BB
Grade
ActiBioPure™, Bioactive, Carrier Free, PBS Only
Specifications & Purity
Carrier Free, Bioactive, ActiBioPure™, PBS Only, ≥95%(SDS-PAGE), See COA
Biochemical and Physiological Mechanisms
PDGF-BB is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. This gene product can exist either as a homodimer
Bioactivity
Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.78 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
74-182
Sequence
SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPVFKKATVTLEDHLACKCETVVTPRPVT
Accession #
Predicted molecular weight
12.2 kDa
SDS-PAGE
13.5 kDa, under reducing conditions; 29.8 kDa, under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Concentration
See COA
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃ for 12 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images
Recombinant Rat PDGF-BB Protein (rp186540) - Protein Bioactivity
Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED₅₀ for this effect is 0.78 ng/mL.
Recombinant Rat PDGF-BB Protein (rp186540) - SDS-PAGE
 1 μg/lane of Recombinant Rat PDGF-BB Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 13.5 kDa under reducing conditions and 29.8 kDa under non-reducing conditions. Rat PDGF-BB are disulfide-linked Antiparallel homodimer.PDGFRα can be activated by homodimeric PDGF-AA, PDGF-BB, and PDGF-CC, and heterodimeric PDGF-AB (PMID: 20534510).

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.