Recombinant Sumo Protease Protein

Cat. No.: rp176272
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥90%(SDS-PAGE)
Expression System
E. coli
Accession #
Q02724
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
≥ 200 Units/μg; Measured by its ability to be proteolytically processed by substrate protein, one unit of SUMO Protease is defined as the amount of enzyme needed to cleave 85% of 2µg of substrate protein at 30°C in one hour.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp176272-10μg
≥10
$159.90
100μg
rp176272-100μg
10
$559.90
1mg
rp176272-1mg
1
$3,999.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Bioactive,ActiBioPure™,Azide Free,High Performance,His-Tag,≥90%(SDS-PAGE) ActiBioPure™,Azide Free,Bioactive,Carrier Free,High Performance,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Purity:>90%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description:
Protease that catalyzes two essential functions in the SUMO pathway: processing of full-length SMT3 to its mature form and deconjugation of SMT3 from targeted proteins. Has an essential role in the G2/M phase of the cell cycle. Probable centromere protein from the fission yeast (Schizosaccharomyces pombe). Similar to yeast Smt3p-specific protease, degrades conjugated ubiquitin-like protein [S. pombe].

Specifications

Product Name
Recombinant Sumo Protease Protein
Synonyms
Ubiquitin-like-specific protease 1 | ULP1 | SUMO protease ULP1
Grade
ActiBioPure™, Azide Free, Bioactive, Carrier Free, High Performance, His Tag
Specifications & Purity
Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, His-Tag, ≥90%(SDS-PAGE)
Bioactivity
≥ 200 Units/μg; Measured by its ability to be proteolytically processed by substrate protein, one unit of SUMO Protease is defined as the amount of enzyme needed to cleave 85% of 2µg of substrate protein at 30°C in one hour.
Endotoxin Concentration
<1.0 EU/μg
Expression System
E. coli
Amino Acids
403-621 aa
Sequence
MHHHHHHLVPELNEKDDDQVQKALASRENTQLMNRDNIEITVRDFKTLAPRRWLNDTIIEFFMKYIEKSTPNTVAFNSFFYTNLSERGYQGVRRWMKRKKTQIDKLDKIFTPINLNQSHWALGIIDLKKKTIGYVDSLSNGPNAMSFAILTDLQKYVMEESKHTIGEDFDLIHLDCPQQPNGYDCGIYVCMNTLYGSADAPLDFDYKDAIRMRRFIAHLILTDALK
Protein Tag
N-His
Accession #
Predicted molecular weight
26.4 kDa
SDS-PAGE
25.8kDa, reducing conditions; 25.8 kDa, non-reducing condition
Molecule Type
Protein
Storage and Shipping
Shape
Lyophilized
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C stable up to 1 year. Avoid freeze/thaw cycle.
Images

Recombinant Sumo Protease Protein (rp176272) - SDS-PAGE
Recombinant Sumo Protease Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 25.8 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeDateItem
ZJ23F1201956Certificate of AnalysisApr 13, 2026 rp176272
ZJ23F1201957Certificate of AnalysisApr 13, 2026 rp176272
ZJ23F1201958Certificate of AnalysisApr 13, 2026 rp176272
ZJ23R1200171Certificate of AnalysisDec 05, 2023 rp176272
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.