Recombinant Human CD300c Protein, ≥95% (SDS-PAGE)

Cat. No.: rp143943
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
Q08708
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated human T cells. Human T lymphocytes cultured for 72 hours with PHA were incubated for an additional 3 days in 96 well plates coated with 500 ng/mL antiCD3 and Recombinant Human CD300c Fc Chimera. The ED50 for this effect is 4-16 μg/mL.
Size
USA
Germany (EU)*
Price
Qty
10μg
rp143943-10μg
9 In stock
$121.90
50μg
rp143943-50μg
3 In stock
$335.90
100μg
rp143943-100μg
1 In stock
$499.90
1mg
rp143943-1mg
US Made to order · 2–4 wks ·
$3,139.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,High Performance,His-Tag,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,High Performance,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Purity
≥95% (SDS-PAGE)
Endotoxin level
<0.1 EU/μg
Function
Leukocyte mono-Ig-like receptor 2 (LMIR2; also CMRF-35, CMRF35-A antigen, and CD300c antigen) is a 23 kDa (predicted) type I transmembrane glycoprotein that belongs to the immunoregulatory signaling (IRS) family of molecules within the immunoglobulin (Ig) superfamily. Human LMIR2 is synthesized as a 224 amino acid (aa) precursor that has a 20 aa signal sequence, a 163 aa extracellular domain (ECD), a 21 aa transmembrane region, and a 20 aa cytoplasmic tail (SwissProt # Q08708). The ECD contains an Ig-like V-type domain (aa’s 22-128) and two N-linked glycosylation sites (aa’s 90 and 99). Downstream of the Ig V-domain, the membrane proximal region of LMIR2 (aa 128-183) contains a high proportion of proline (18%), serine (20%) and threonine (13%) residues. The transmembrane segment contains a charged glutamic acid that contributes to cell activation. Human LMIR2 shares 52% aa sequence identity with the mouse LMIR2, which is also known as CLM4. Human LMIR2 is 90% identical to human LMIR1 within the Ig-like domain. LMIR2 is present on the surface of natural killer cells, granulocytes, most myeloid cells, dendritic cells, and a subpopulation of T and B lymphocytes.

Specifications

Product Name
Recombinant Human CD300c Protein, ≥95% (SDS-PAGE)
Synonyms
CD300 antigen-like family member C | CLM-6 | CMRF-35 | CMRF35-A1 | IgSF16 | Immunoglobulin superfamily member 16 | CD300 antigen-like family member C | CD300c | CD300c antigen | CD300c molecule | CLM-6 | CLM6_HUMAN | CMRF-35 | CMRF-35A | CMRF35 | CMRF35 a
Grade
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance, His Tag
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, His-Tag, ≥95%(SDS-PAGE)
Purity
≥95% (SDS-PAGE)
Bioactivity
Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated human T cells. Human T lymphocytes cultured for 72 hours with PHA were incubated for an additional 3 days in 96 well plates coated with 500 ng/mL antiCD3 and Recombinant Human CD300c Fc Chimera. The ED50 for this effect is 4-16 μg/mL.
Endotoxin Concentration
<0.1 EU/μg
Expression System
HEK293
Species
Human
Amino Acids
21-183 aa
Sequence
GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVRHHHHHH
Protein Tag
C-His
Accession #
Predicted molecular weight
45 kDa
SDS-PAGE
40 - 50 kDa, under reducing conditions; 40 - 50 kDa, under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Shape
Lyophilized
Reconstitution
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images

Recombinant Human CD300c Protein (rp143943) - SDS-PAGE
3 μg/lane of Recombinant Human CD300c Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 40 - 50 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ24F1214664Certificate of AnalysisJul 15, 2026 rp143943
ZJ24F1214665Certificate of AnalysisJul 15, 2026 rp143943
ZJ24F1214666Certificate of AnalysisJul 15, 2026 rp143943
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.