Recombinant Human Pin1 Protein

Cat. No.: rp184932
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. ≥95%(SDS-PAGE) expressed in E. coli; See COA
Accession #
Q13526
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human Pin1 Protein (rp184932) at 1.0 μg/mL can bind Recombinant Pin1 Antibody (Ab121891) with the EC50 of 71.76 ng/mL.​
Size
Status
Price
Qty
10μg
rp184932-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$89.90
50μg
rp184932-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$269.90
100μg
rp184932-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$429.90
1mg
rp184932-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$2,659.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free, Bioactive, ActiBioPure™, ≥95%(SDS-PAGE), expressed in E. coli; See COA ActiBioPure™,Bioactive,Carrier Free for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human Pin1 Protein
Synonyms
peptidylprolyl cis/trans isomerase, NIMA-interacting 1 | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 | EC 5.2.1.8 | Rotamase Pin1 | PPIase Pin1 | DOD | UBL5 | PIN1 | PPIase.
Grade
ActiBioPure™, Bioactive, Carrier Free
Specifications & Purity
Carrier Free, Bioactive, ActiBioPure™, ≥95%(SDS-PAGE), expressed in E. coli; See COA
Biochemical and Physiological Mechanisms
Human Pin 1 is a peptidyl-prolyl cis/trans isomerase (PPIase) that interacts with NIMA and essential for cell cycle regulation Pin1 is nuclear PPIase containing a WW protein interaction domain, and is structurally and functionally related to Ess1/Ptf1, an
Bioactivity
Immobilized Recombinant Human Pin1 Protein (rp184932) at 1.0 μg/mL can bind Recombinant Pin1 Antibody (Ab121891) with the EC50 of 71.76 ng/mL.​
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
2 -163 aa
Sequence
ADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE​
Accession #
Predicted molecular weight
18.1 kDa
SDS-PAGE
16.7 kDa; under reducing conditions; 17.0 & 33.0 & 50.0 & 67.3 kDa; under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Concentration
expressed in E. coli; See COA
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃ for 12 months. Upon receipt; it is recommended to aliquot. Avoid freeze/thaw cycle.
Images
Recombinant Human Pin1 Protein (rp184932) - ELISA 
Immobilized Recombinant Human Pin1 Protein (rp184932) at 1.0 μg/mL can bind Recombinant Pin1 Antibody (Ab121891) with the EC50 of 71.76 ng/mL.
Recombinant Human Pin1 Protein (rp184932) - SDS-PAGE 
3 μg/lane of Recombinant Human Pin1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 16.7 kDa under reducing conditions and 17.0 & 33.0 & 50.0 & 67.3 kDa under non-reducing conditions. PIN1 forms polymers through its N-terminal WW domain and the flexible hinge region under non-reducing conditions (PMID: 10932246).

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ26F0434785Certificate of AnalysisApr 28, 2026 rp184932
ZJ26F0434784Certificate of AnalysisApr 28, 2026 rp184932
ZJ26F0434783Certificate of AnalysisApr 28, 2026 rp184932
Solution Calculators
Reviews

Customer Reviews

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide → View Bioactive grade guide → View ActiBioPure™ grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.