Recombinant Human RPL26L1 Protein

Cat. No.: rp192207
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥90%(SDS-PAGE) expressed in E. coli; See COA
Accession #
Q9UNX3
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human RPL26L1 Protein (rp192207) at 1.0 μg/mL can bind Recombinant RPL26L1 Antibody (Ab125812) with the EC50 of 10.6 ng/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp192207-10μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$139.90
50μg
rp192207-50μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$399.90
100μg
rp192207-100μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$629.90
1mg
rp192207-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$3,699.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Bioactive,ActiBioPure™,His Tag,≥90%(SDS-PAGE),expressed in E. coli; See COA ActiBioPure™,Bioactive,Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human RPL26L1 Protein
Synonyms
FLJ46904 | ribosomal protein L26 homolog | ribosomal protein L26 pseudogene 1 | ribosomal protein L26-like 1 | RPL26P1 | 60S ribosomal protein L26-like 1 | RPL26L1 | Ribosomal protein uL24-like | Large ribosomal subunit protein uL24-like 1 | Ribosomal Pro
Grade
ActiBioPure™, Bioactive, Carrier Free, His Tag
Specifications & Purity
Carrier Free, Bioactive, ActiBioPure™, His Tag, ≥90%(SDS-PAGE), expressed in E. coli; See COA
Biochemical and Physiological Mechanisms
60S ribosomal protein L26-like 1 (RPL26L1) is a member of the ribosomal protein family and has a role in protein synthesis. RPL26L1 is situated in the cytoplasm. RPL26L1 shares a great sequence similarity with ribosomal protein L26. Currently it is unknow
Bioactivity
Immobilized Recombinant Human RPL26L1 Protein (rp192207) at 1.0 μg/mL can bind Recombinant RPL26L1 Antibody (Ab125812) with the EC50 of 10.6 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
2-145 aa
Sequence
MHHHHHHKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEELIEKMQE​
Accession #
Predicted molecular weight
18.1 kDa
SDS-PAGE
18.9 kDa, under reducing conditions; 18.9 kDa, under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Concentration
expressed in E. coli; See COA
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃ long term (12 months). Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images
Recombinant Human RPL26L1 Protein (rp192207) - Protein Bioactivity 
Immobilized Recombinant Human RPL26L1 Protein (rp192207) at 1.0 μg/mL can bind Recombinant RPL26L1 Antibody (Ab125812) with the EC₅₀ of 10.6 ng/mL.
Recombinant Human RPL26L1 Protein (rp192207) - SDS-PAGE 
2 μg/lane of Recombinant Human RPL26L1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 18.9 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ26F0434577Certificate of AnalysisApr 23, 2026 rp192207
ZJ26F0434578Certificate of AnalysisApr 23, 2026 rp192207
ZJ26F0434579Certificate of AnalysisApr 23, 2026 rp192207
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.