Recombinant Human TL1A/TNFSF15 Protein

Cat. No.: rp310063
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. ≥95%(SDS-PAGE) expressed in E. col; See COA
Accession #
O95150
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
TF-1 cells were co-stimulated with 5.0 μg/mL CHX (C112766) and 200.0 ng/mL Recombinant Human TL1A/TNFSF15 Protein (rp170417) for 24 hours. Cells were then stained with Annexin V-FITC/PI Apoptosis Detection Kit (A1372286) and analyzed by FACS.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp310063-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$79.90
50μg
rp310063-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$249.90
100μg
rp310063-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$399.90
1mg
rp310063-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$2,399.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,ActiBioPure™,High Performance,≥95%(SDS-PAGE),expressed in E. col; See COA ActiBioPure™,Carrier Free,High Performance for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human TL1A/TNFSF15 Protein
Synonyms
MGC129934 | MGC129935 | TL1A | TL1Vascular endothelial cell growth inhibitor | TNF superfamily ligand TL1A | TNFSF15 | tumor necrosis factor (ligand) superfamily, member 15 | tumor necrosis factor ligand superfamily member 15 | vascular endothelial growth
Grade
ActiBioPure™, Carrier Free, High Performance
Specifications & Purity
Carrier Free, ActiBioPure™, High Performance, ≥95%(SDS-PAGE), expressed in E. col; See COA
Biochemical and Physiological Mechanisms
TL1A is a type II transmembrane protein belonging to the TNF superfamily and has been designated TNF superfamily member 15 (TNFSF15). Human TL1A is a 251 aa protein consisting of a 35 aa cytoplasmic domain, a 24 aa transmembrane region and a 192 aa C-term
Bioactivity
TF-1 cells were co-stimulated with 5.0 μg/mL CHX (C112766) and 200.0 ng/mL Recombinant Human TL1A/TNFSF15 Protein (rp170417) for 24 hours. Cells were then stained with Annexin V-FITC/PI Apoptosis Detection Kit (A1372286) and analyzed by FACS.
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
72-251aa
Sequence
LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Accession #
Predicted molecular weight
20.4 kDa
SDS-PAGE
19.8 kDa, under reducing conditions; 18.4 & 20.7 & 32.5 & 40.4 kDa, under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Concentration
expressed in E. col; See COA
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃ for 12 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images
Recombinant Human TL1A/TNFSF15 Protein (rp310063) - Protein Bioactivity 
TF-1 cells were co-stimulated with 5.0 μg/mL CHX (C112766) and 200.0 ng/mL Recombinant Human TL1A/TNFSF15 Protein (rp310063) for 24 hours. Cells were then stained with Annexin V-FITC/PI Apoptosis Detection Kit (A1372286) and analyzed by FACS.
Recombinant Human TL1A/TNFSF15 Protein (rp310063) - SDS-PAGE 
3 μg/lane of Recombinant Human TL1A/TNFSF15 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the bands at 19.8 kDa under reducing conditions and 18.4 & 20.7 & 32.5 & 40.4 kDa under non-reducing conditions. Homologous trimers linked by disulfide bonds (PMID: 17935696, PMID: 21300286) .

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ26F0333355Certificate of AnalysisMar 25, 2026 rp310063
ZJ26F0333356Certificate of AnalysisMar 25, 2026 rp310063
ZJ26F0333357Certificate of AnalysisMar 25, 2026 rp310063
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.