Recombinant Human UQCRH Protein

Cat. No.: rp188437
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥90%(SDS-PAGE) See COA
Accession #
P07919
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human UQCRH Protein (rp188437) at 1.0 μg/mL can bind Recombinant UQCRH Antibody (Ab133593) with the EC50 of 32.5 ng/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp188437-10μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$89.90
50μg
rp188437-50μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$269.90
100μg
rp188437-100μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$429.90
1mg
rp188437-1mg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$2,599.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Bioactive,ActiBioPure™,PBS Only,≥90%(SDS-PAGE),See COA ActiBioPure™,Bioactive,Carrier Free,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human UQCRH Protein
Synonyms
Complex III subunit 6 | Complex III subunit VIII | Cytochrome c1 non-heme 11 kDa protein | Mitochondrial hinge protein | Ubiquinol-cytochrome c reductase complex 11 kDa protein | UQCRH
Grade
ActiBioPure™, Bioactive, Carrier Free, PBS Only
Specifications & Purity
Carrier Free, Bioactive, ActiBioPure™, PBS Only, ≥90%(SDS-PAGE), See COA
Biochemical and Physiological Mechanisms
Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succina
Bioactivity
Immobilized Recombinant Human UQCRH Protein (rp188437) at 1.0 μg/mL can bind Recombinant UQCRH Antibody (Ab133593) with the EC50 of 32.5 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
14-91 aa
Sequence
GGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK
Accession #
Predicted molecular weight
9.2 kDa
SDS-PAGE
10.0 & 15.5 kDa, under reducing conditions; 10.0 & 15.5 kDa, under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Concentration
See COA
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃ for 6 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images
Recombinant Human UQCRH Protein (rp188437) - ELISA
Immobilized Recombinant Human UQCRH Protein (rp188437) at 1.0 μg/mL can bind Recombinant UQCRH Antibody (Ab133593) with the EC₅₀ of 32.5 ng/mL.
Recombinant Human UQCRH Protein (rp188437) - SDS-PAGE 
2 μg/lane of Recombinant Human UQCRH Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 10.0 & 15.5 kDa under reducing conditions and 10.0 & 15.5 kDa under non-reducing conditions. The observation of protein as both dimers and monomers under non-reducing (NR) conditions suggests that a portion of the protein forms dimers. This dimerization may be mediated by (or stabilized by) disulfide bonds (Uniprot: P07919).

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.