Recombinant Human CFLAR Protein

Cat. No.: rp189315
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. DNase, RNase free ? Free of DNase and RNase activity to keep DNA and RNA intact. Use in nucleic-acid extraction, PCR, and storage where degradation is a risk. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Low Endotoxin ? Low-endotoxin grade — endotoxin reduced to low controlled levels. Use in sensitive biological work where high endotoxin would interfere. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥90%(SDS-PAGE) See COA
Accession #
O15519
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Size
USA
Germany (EU)*
Price
Qty
10μg
rp189315-10μg
3 In stock
$215.90
50μg
rp189315-50μg
3 In stock
$645.90
100μg
rp189315-100μg
3 In stock
$1,033.90
1mg
rp189315-1mg
US Made to order · 2–4 wks ·
$4,999.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,DNase, RNase free,ActiBioPure™,Low Endotoxin,High Performance,His-Tag,≥90%(SDS-PAGE),See COA ActiBioPure™,Animal Free,Bioactive,Carrier Free,DNase, RNase free,High Performance,His Tag,Low Endotoxin for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human CFLAR Protein
Synonyms
c FLIP | c FLIPL | c FLIPR | c FLIPS | c-FLIP | c-FLIPL | c-FLIPR | Usurpin beta | Usurpin | OTTHUMP00000207360 | OTTHUMP00000206482 | OTTHUMP00000206480 | OTTHUMP00000206479 | OTTHUMP00000206478 | OTTHUMP00000206476 | OTTHUMP00000206475 | c-FLIPS | CASH
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, DNase, RNase free, High Performance, His Tag, Low Endotoxin
Specifications & Purity
Animal Free,Carrier Free,Bioactive,DNase, RNase free,ActiBioPure™,Low Endotoxin,High Performance,His-Tag,≥90%(SDS-PAGE),See COA
Biochemical and Physiological Mechanisms
Apoptosis regulator protein which may function as a crucial link between cell survival and cell death pathways in mammalian cells. Acts as an inhibitor of TNFRSF6 mediated apoptosis. A proteolytic fragment (p43) is likely retained in the death-inducing si
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
2-277 aa
Sequence
MHHHHHHSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYE​
Accession #
Predicted molecular weight
32.7 kDa
SDS-PAGE
29.2 kDa, under reducing conditions; 29.2 & 60.7 kDa, under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Concentration
See COA
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃ for 12 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images

Recombinant Human CFLAR Protein (rp189315) - SDS-PAGE
3 μg/lane of Recombinant Human CFLAR Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 29.2 kDa under reducing conditions and 29.2 & 60.7 kDa under non-reducing conditions.
The observation of CFLAR Protein as both dimers and monomers under non-reducing (NR) conditions suggests that a portion of the protein forms dimers. This dimerization may be mediated by (or stabilized by) disulfide bonds (Uniprot: O15519).

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ25F0724459Certificate of AnalysisMay 19, 2026 rp189315
ZJ25F0724460Certificate of AnalysisMay 19, 2026 rp189315
ZJ25F0724461Certificate of AnalysisMay 19, 2026 rp189315
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.