Recombinant Human FGF acidic/FGF1 Protein

Cat. No.: rp170413
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. ≥95%(SDS-PAGE)
Expression System
E. coli
Accession #
P05230
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured in a cell proliferation assay using BALB/3T3 mouse embryo fibroblasts cell line in the presence of 10 µg/mL heparin sodium (H104201). The ED50 for this effect is typically 0.28 ng/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp170413-10μg
7
$59.90
50μg
rp170413-50μg
4
$139.90
100μg
rp170413-100μg
4
$219.90
1mg
rp170413-1mg
1
$1,339.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

ActiBioPure™, Bioactive, Carrier Free, High performance, ≥95%(SDS-PAGE) ActiBioPure™,Bioactive,Carrier Free,High Performance for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Protein Function:
FGF acidic, also known as FGF1, ECGF, and HBGF-1, is a 17 kDa nonglycosylated member of the FGF family of mitogenic peptides. FGF acidic, which is produced by multiple cell types, stimulates the proliferation of all cells of mesodermal origin and many cells of neuroectodermal, ectodermal, and endodermal origin. It plays a number of roles in development, regeneration, and angiogenesis. Human FGF acidic shares 54% amino acid sequence identity with FGF basic and 17%‑33% with other human FGFs. It shares 92%, 96%, 96%, and 96% aa sequence identity with bovine, mouse, porcine, and rat FGF acidic, respectively, and exhibits considerable species crossreactivity. Alternate splicing generates a truncated isoform of human FGF acidic that consists of the N-terminal 40% of the molecule and functions as a receptor antagonist. During its nonclassical secretion, FGF acidic associates with S100A13, copper ions, and the C2A domain of synaptotagmin 1. It is released extracellularly as a disulfide-linked homodimer and is stored in complex with extracellular heparan sulfate. The ability of heparan sulfate to bind FGF acidic is determined by its pattern of sulfation, and alterations in this pattern during embryogenesis thereby regulate FGF acidic bioactivity. The association of FGF acidic with heparan sulfate is a prerequisite for its subsequent interaction with FGF receptors. Ligation triggers receptor dimerization, transphosphorylation, and internalization of receptor/FGF complexes. Internalized FGF acidic can translocate to the cytosol with the assistance of Hsp90 and then migrate to the nucleus by means of its two nuclear localization signals. The phosphorylation of FGF acidic by nuclear PKC delta triggers its active export to the cytosol where it is dephosphorylated and degraded. Intracellular FGF acidic functions as a survival factor by inhibiting p53 activity and proapoptotic signaling.

Specifications

Product Name
Recombinant Human FGF acidic/FGF1 Protein
Synonyms
AFGF | alpha | alpha-ECGF | beta-ECGF | ECGF | ECGFB | ECGF-betaAcidic fibroblast growth factor | endothelial cell growth factor, beta | FGF acidic | FGF-1 | FGFABeta-endothelial cell growth factor | FGF-alpha | fibroblast growth factor 1 (acidic) | GLIO7
Grade
ActiBioPure™, Bioactive, Carrier Free, High Performance
Specifications & Purity
ActiBioPure™, Bioactive, Carrier Free, High performance, ≥95%(SDS-PAGE)
Bioactivity
Measured in a cell proliferation assay using BALB/3T3 mouse embryo fibroblasts cell line in the presence of 10 µg/mL heparin sodium (H104201). The ED50 for this effect is typically 0.28 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Expression System
E. coli
Amino Acids
16-155 aa
Sequence
FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Protein Tag
No tag
Accession #
Predicted molecular weight
15.9 kDa
SDS-PAGE
14.3 kDa, under reducing conditions; 14.2 kDa, under non-reducing conditions
Molecule Type
Protein
Storage and Shipping
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Images

Recombinant Human FGF acidic/FGF1 Protein (rp170413) - Protein Bioactivity
Measured in a cell proliferation assay using BALB/3T3 mouse embryo fibroblasts cell line in the presence of 10 µg/mL heparin sodium (H104201). The ED₅₀ for this effect is typically 0.28 ng/mL.

Recombinant Human FGF acidic/FGF1 Protein (rp170413) - SDS-PAGE
3 μg/lane of Recombinant Human FGF acidic/FGF1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 14.3 kDa under reducing conditions and 14.2 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeDateItem
ZJ24F1013042Certificate of AnalysisJun 15, 2026 rp170413
ZJ24F1013043Certificate of AnalysisJun 15, 2026 rp170413
ZJ24F1013044Certificate of AnalysisJun 15, 2026 rp170413
ZJ24F1013045Certificate of AnalysisJun 15, 2026 rp170413
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.