Recombinant Human SCF GMP Protein

Cat. No.: rp168367-GMP
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. ≥75%(SDS-PAGE&SEC-HPLC)
Expression System
E. coli
Accession #
P21583.1
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 1.00-8.00 ng/mL. The specific activity of recombinant human SCF is >1.0 x 10^6 units/mg, which is calibrated against the human SCF reference standard
Size
Status
Price
Qty
50μg
rp168367-GMP-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.

$694.90

$929.90
Save $235.00 (25.27%)
1mg
rp168367-GMP-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$7,439.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,≥75%(SDS-PAGE&SEC-HPLC) ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human SCF GMP Protein
Synonyms
c-kit Ligand | DCUA | DFNA69 | DKFZp686F2250 | familial progressive hyperpigmentation 2 | FPH2 | FPHH | KIT ligand | Kitl | KITLG | KL-1 | Mast cell growth factor | MGF | WS2F | SF | steel factor | SLF | SCF | SCFStem cell factor | SFc-Kit ligand | SHEP7
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, ≥75%(SDS-PAGE&SEC-HPLC)
Biochemical and Physiological Mechanisms
Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesi
Bioactivity
Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 1.00-8.00 ng/mL. The specific activity of recombinant human SCF is >1.0 x 10^6 units/mg, which is calibrated against the human SCF reference standard
Endotoxin Concentration
<0.1 EU/μg
Expression System
E. coli
Amino Acids
26-189 aa
Sequence
MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA
Protein Tag
No tag
N-terminal Sequence
Met-Glu26-Gly-Ile-(Cys)-Arg-Asn-Arg-Val-Thr
Accession #
Predicted molecular weight
19 kDa
SDS-PAGE
18 kDa, under reducing conditions
Molecule Type
Protein
Storage and Shipping
Reconstitution
Reconstitute at 500 μg/mL in PBS.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
A minimum of 12 months when stored at ≤ -20 ℃ as supplied. 1 month, 2 to 8 ℃ under sterile conditions after reconstitution. 3 months, ≤ -28 ℃ under sterile conditions after reconstitution. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycl

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.