Recombinant Mouse CD47 Protein

Cat. No.: rp167416
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
NP_034711
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Measured by its binding ability in a functional ELISA. When Recombinant Mouse SIRP alpha /CD172a Fc Chimera is coated at 2 μg/mL, Recombinant Mouse CD47 binds with an apparent Kd <0.6 nM. Also measured by its ability to antagonize mouse red blood cell adhesion to immobilized Recombinant Mouse SIRP alpha /CD172a Fc Chimera. The ED50 for this effect is 2.0-8.0 μg/mL. Optimal dilutions should be determined by each laboratory for each application.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp167416-10μg
7
$139.90
50μg
rp167416-50μg
3
$409.90
100μg
rp167416-100μg
1
$609.90
1mg
rp167416-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$3,049.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,His-Tag,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus (By similarity). Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection.

Specifications

Product Name
Recombinant Mouse CD47 Protein
Synonyms
antigen identified by monoclonal 1D8 | Antigenic surface determinant protein OA3 | CD47 antigen (Rh-related antigen, integrin-associated signal transducer) | CD47 antigen | CD47 glycoprotein | CD47 molecule | CD47 | IAP | IAPintegrin associated protein |
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, His Tag
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, His-Tag, ≥95%(SDS-PAGE)
Bioactivity
Measured by its binding ability in a functional ELISA. When Recombinant Mouse SIRP alpha /CD172a Fc Chimera is coated at 2 μg/mL, Recombinant Mouse CD47 binds with an apparent Kd <0.6 nM. Also measured by its ability to antagonize mouse red blood cell adhesion to immobilized Recombinant Mouse SIRP alpha /CD172a Fc Chimera. The ED50 for this effect is 2.0-8.0 μg/mL. Optimal dilutions should be determined by each laboratory for each application.
Endotoxin Concentration
<0.1 EU/μg
Expression System
HEK293
Amino Acids
19-158 aa
Sequence
QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNTDQGSACSYEEEKGGCKLVSWFSPHHHHHH
Protein Tag
C-His
Accession #
Predicted molecular weight
16.51 kDa
SDS-PAGE
30 - 45 kDa, under reducing conditions; 30 - 45 & 60 - 90 kDa, under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Reconstitution
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images

Recombinant Mouse CD47 Protein (rp167416) - SDS-PAGE
2 μg/lane of Recombinant Mouse CD47 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 30 - 45 kDa under reducing conditions and 30 - 45 & 60 - 90 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.