Ocriplasmin, CAS No.1048016-09-6

CAS: 1048016-09-6 Cat. No.: rp174677
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. Recombinant ? Recombinant — produced via recombinant expression for defined sequence and consistency. Use for reproducible, animal-free proteins of known origin. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. EnzymoPure™ ? EnzymoPure™ — Aladdin's line of high-quality enzymatic solutions. Use when enzyme purity and defined activity drive assay or process performance. ≥90%(SDS-PAGE) expressed in Pichia pastoris
Accession #
P00747
Protein Tag
No tag
Expression system
Pichia pastoris
Bioactivity
No activation needed, activated protein supplied.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp174677-10μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$1,334.90
50μg
rp174677-50μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$1,334.90
100μg
rp174677-100μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$619.90
500μg
rp174677-500μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$1,899.90
1mg
rp174677-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$3,099.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,Recombinant,ActiBioPure™,High Performance,EnzymoPure™,≥90%(SDS-PAGE),expressed in Pichia pastoris ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,Recombinant,EnzymoPure™ for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Ocriplasmin is a synthetic form of the serine protease, plasmin. It contains a truncated heavy chain peptide sequence and full length light chain. Sequences can be found in the DrugBank entry.

Specifications

Product Name
Ocriplasmin, CAS No.1048016-09-6
Synonyms
Jetrea, microplasmin | Plasmin | Jetrea® | microplasmin | Plasminogen | PLG | HAE4 | plasmin | fibrinase | fibrinolysin
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, Recombinant, EnzymoPure™
Specifications & Purity
Animal Free, Carrier Free, Bioactive, Recombinant, ActiBioPure™, High Performance, EnzymoPure™, ≥90%(SDS-PAGE), expressed in Pichia pastoris
Biochemical and Physiological Mechanisms
Plasmin dissolves the fibrin of blood clots and acts as a proteolytic factor in a variety of other processes including embryonic development, tissue remodeling, tumor invasion, and inflammation. In ovulation, weakens the walls of the Graafian follicle. It
Bioactivity
No activation needed, activated protein supplied.
Amino Acids
562-810 aa
Sequence
APSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN
Accession #
Predicted molecular weight
27.2 kDa
SDS-PAGE
27 kDa, under reducing conditions.
CAS
1048016-09-6
Molecule Type
Enzyme
Storage and Shipping
Concentration
expressed in Pichia pastoris
Reconstitution
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20~-80℃ long term (1 year). Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Genetic information
Alternate NamesJetrea,microplasmin | Plasmin | Jetrea® | microplasmin | Plasminogen | PLG | HAE4 | plasmin | fibrinase | fibrinolysin
Reference
  • 1. Kinetics and inhibition of recombinant human cystathionine gamma-lyase. Toward the rational control of transsulfuration., The Journal of biological chemistry, Steegborn, C C and 7 more authors.
  • 2. Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences., Proceedings of the National Academy of Sciences of the United States of America, Strausberg, Robert L RL and 83 more authors.
  • 3. Genomic basis of cystathioninuria (MIM 219500) revealed by multiple mutations in cystathionine gamma-lyase (CTH)., Human genetics, Wang, Jian J and Hegele, Robert A RA.
  • 4. Cloning and nucleotide sequence of human liver cDNA encoding for cystathionine gamma-lyase., Biochemical and biophysical research communications, Lu, Y Y, O'Dowd, B F BF, Orrego, H H and Israel, Y Y.
  • 5. Single nucleotide polymorphism in CTH associated with variation in plasma homocysteine concentration., Clinical genetics, Wang, J J, Huff, A M AM, Spence, J D JD and Hegele, R A RA.
  • 6. Cystathionine gamma-lyase overexpression inhibits cell proliferation via a H2S-dependent modulation of ERK1/2 phosphorylation and p21Cip/WAK-1., The Journal of biological chemistry, Yang, Guangdong G, Cao, Kun K, Wu, Lingyun L and Wang, Rui R.
  • 7. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)., Genome research, Gerhard, Daniela S DS and 115 more authors.
  • 8. Towards a proteome-scale map of the human protein-protein interaction network., Nature, Rual, Jean-François JF and 37 more authors.
  • 9. The DNA sequence and biological annotation of human chromosome 1., Nature, Gregory, S G SG and 178 more authors.
  • 10. Polymorphisms in one-carbon metabolism and trans-sulfuration pathway genes and susceptibility to bladder cancer., International journal of cancer, Moore, Lee E LE and 14 more authors. more
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.