Recombinant Human HE4/WFDC2 Protein

Cat. No.: rp181298

GRADE & PURITY Animal Free, Carrier Free, His Tag, PBS Only, ≥95%(SDS-PAGE)

Expression System

HEK293

Accession #

Q14508

Protein Tag

C-His

Expression system

HEK293

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Testing in progress

Overview

Purity: ≥95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description：
HE4 (also WFDC2; WAP Four-disulfide core domain protein 2) is a secreted, 25 kDa glycoprotein member of the Whey Acidic Protein family of molecules. It is expressed by a wide variety of epithelial cells, including respiratory epithelium, salivary gland mucous cells, breast duct epithelium, distal tubule renal epithelium, and epididymal epithelium. It is believed to play a role in innate defense, and/or function as a protease inhibitor (perhaps for neutrophil elastase). Ovarian epithelial tumors have an increased expression of HE4, leading to the suggestion that HE4 could represent a tumor marker for ovarian cancer. Mature human HE4 is 94 amino acids (aa) in length. It contains two WAP domains that likely mediate antiprotease and/or antimicrobial activity (aa 31‑73 and 74‑123). There are four potential splice variants. One shows a deletion of aa 27‑74, while three others show aa substitutions: 28 aa for aa 75‑124, 23 aa for aa 1‑74, and 10 aa for aa 71‑124. Over aa 31‑124, human HE4 shares 63% aa identity with an extended (144 amino acid) mouse form of mature HE4.

Specifications

Product Name

Recombinant Human HE4/WFDC2 Protein

Synonyms

dJ461P17.6 | EDDM4 | Epididymal secretory protein E4 | epididymis-specific, whey-acidic protein type, four-disulfide core | HE4 | HE4MGC57529 | Major epididymis-specific protein E4 | Putative protease inhibitor WAP5 | WAP domain containing protein HE4-V4

Grade

Animal Free, Carrier Free, His Tag, PBS Only

Specifications & Purity

Animal Free, Carrier Free, His Tag, PBS Only, ≥95%(SDS-PAGE)

Bioactivity

Testing in progress

Endotoxin Concentration

<1.0 EU/μg

Expression System

HEK293

Amino Acids

1-124 aa

Sequence

MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNFHHHHHH

Protein Tag

C-His

Accession #

Q14508

Predicted molecular weight

10.8 kDa

SDS-PAGE

19.3-25.3 kDa, under reducing conditions; 19.3-25.3 kDa, under non-reducing conditions

Molecule Type

Protein

Storage and Shipping

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Storage

Store at -20°C,Avoid repeated freezing and thawing

Shipped In

Ice chest + Ice pads

Stability And Storage

Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Images

SDS-PAGE: Recombinant Human HE4/WFDC2 Protein (rp181298)

Recombinant Human HE4/WFDC2 Protein(rp181298) - SDS-PAGE
3 μg/lane of Recombinant Human HE4/WFDC2 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 19.3-25.3 kDa.