Recombinant Human IL-29/IFN-lambda 1 Protein

Cat. No.: rp169632
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥90%(SDS-PAGE) expressed in E. coli; See COA
Accession #
Q8IU54
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Testing in progress
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp169632-10μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$69.90
50μg
rp169632-50μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$219.90
100μg
rp169632-100μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$349.90
1mg
rp169632-1mg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$1,189.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,His Tag,≥90%(SDS-PAGE),expressed in E. coli; See COA Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human IL-29/IFN-lambda 1 Protein
Synonyms
Interferon lambda-1 | IFN-lambda-1 | Cytokine Zcyto21 | Interleukin-29 | IL-29 | IFNL1 | IL29 | ZCYTO21 | IFNλ1 | IFN lambda 1
Grade
Carrier Free, His Tag
Specifications & Purity
Carrier Free, His Tag, ≥90%(SDS-PAGE), expressed in E. coli; See COA
Biochemical and Physiological Mechanisms
IL-29, also known interferon-lambda 1 (IFN lambda 1), along with IL-28A (IFN lambda 2), IL-28B (IFN lambda 3) and IFN lambda 4, collectively comprise the type III subset of IFNs. IFN lambda s are class II cytokine receptor ligands distantly related to bot
Bioactivity
Testing in progress
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
23-200 aa
Sequence
HHHHHHPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST
Accession #
Predicted molecular weight
22.1 kDa
SDS-PAGE
25.2 kDa, under reducing conditions; 19.5 kDa, under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Concentration
expressed in E. coli; See COA
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃ for 6 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images
Recombinant Human IL-29/IFN-lambda 1 Protein (rp169632) - SDS-PAGE
 3 μg/lane of Recombinant Human IL-29/IFN-lambda 1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 25.2 kDa under reducing conditions and 19.5 kDa under non-reducing conditions. Human IL‑29 (IFN‑λ1), a flexible secreted class II cytokine with exposed loop regions, is prone to N/C‑terminal truncation by host proteases, yielding a minor band 3–5 kDa smaller than the mature protein (PMID: 20712453).

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Solution Calculators
Reviews

Customer Reviews

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide → View His Tag grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.