Recombinant Human AQP4 Protein

Cat. No.: rp225004
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. ≥95%(SDS-PAGE) expressed in E. coli; See COA
Accession #
P55087
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp225004-10μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$159.90
50μg
rp225004-50μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$399.90
100μg
rp225004-100μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$549.90
1mg
rp225004-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$2,659.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,≥95%(SDS-PAGE),expressed in E. coli; See COA Carrier Free for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human AQP4 Protein
Synonyms
AQP 4 | AQP-4 | AQP4 | AQP4_HUMAN | Aquaporin type 4 | Aquaporin-4 | Aquaporin4 | HMIWC 2 | HMIWC2 | Mercurial insensitive water channel | Mercurial-insensitive water channel | MGC22454 | MIWC | WCH 4 | WCH4
Grade
Carrier Free
Specifications & Purity
Carrier Free, ≥95%(SDS-PAGE), expressed in E. coli; See COA
Biochemical and Physiological Mechanisms
Forms a water-specific channel (PubMed : 19383790, PubMed : 7559426, PubMed : 8601457). Plays an important role in brain water homeostasis (PubMed : 37143309). It is involved in glymphatic solute transport and is required for a normal rate of water exchan
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
253-323 aa
Sequence
CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
Accession #
Predicted molecular weight
8 kDa
SDS-PAGE
13.2 kDa, under reducing conditions; 13.2 &19.2 kDa, under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Concentration
expressed in E. coli; See COA
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃ for 12 months. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images
Recombinant Human AQP4 Protein (rp225004) - SDS-PAGE 
3 μg/lane of Recombinant Human AQP4 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the bands at 13.2 kDa under reducing conditions and 13.2 & 19.2 kDa under non-reducing conditions. The AQP4 Cys253-Val323 fragment starts with a cysteine residue. The free thiol group of this cysteine is highly reactive and, under oxidizing conditions, readily forms intermolecular disulfide bonds with another thiol group. This covalently cross-links individual protein molecules together, leading to dimer formation (Uniprot ID: P55087).

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ26F0535764Certificate of AnalysisMay 26, 2026 rp225004
ZJ26F0535763Certificate of AnalysisMay 26, 2026 rp225004
ZJ26F0535762Certificate of AnalysisMay 26, 2026 rp225004
Solution Calculators
Reviews

Customer Reviews

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.