Recombinant Human CD8 alpha Protein

Cat. No.: rp169572

GRADE & PURITY Animal Free, Carrier Free, Bioactive, ActiBioPure™, PBS Only, ≥95%(SDS-PAGE), See COA

Accession #

P01732

Protein Tag

No tag

Expression system

HEK293

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Immobilized Recombinant Human CD8 alpha protein (rp169572) at 1.0 μg/mL can bind CD8 alpha Mouse mAb (Ab095346) with the EC50 of 200.2 ng/mL.

Overview

T-cell surface glycoprotein CD8 alpha chain, also known as CD8a, is a single-pass type I membrane protein. The CD8 glycoprotein is expressed by thymocytes, mature T cells and natural killer (NK) cells and has been implicated in the recognition of monomorphic determinants on major histocompatibility complex (MHC) Class I antigens, and in signal transduction during the course of T-cell activation. Both human and rodent CD8 antigens are comprised of two distinct polypeptide chains, alpha and beta. The Ig domains of CD8 alpha are involved in controlling the ability of CD8 to be expressed. Mutation of B- and F-strand cysteine residues in CD8 alpha reduced the ability of the protein to fold properly and, therefore, to be expressed. Defects in CD8A are a cause of familial CD8 deficiency. Familial CD8 deficiency is a novel autosomal recessive immunologic defect characterized by absence of CD8+ cells, leading to recurrent bacterial infections. 
Post-translational: Palmitoylated, but association with CD8B seems to be more important for the enrichment of CD8A in lipid rafts. O-glycosylated. Phosphorylated in cytotoxic T-lymphocytes (CTLs) following activation.

Specifications

Product Name

Recombinant Human CD8 alpha Protein

Synonyms

CD_antigen: CD8a | CD8 antigen, alpha polypeptide (p32) | CD8 | CD8a molecule | CD8A | Leu2 T-lymphocyte antigen | LEU2 | MAL | OKT8 T-cell antigen | p32 | T cell co-receptor | T8 T-cell antigen | T-cell antigen Leu2 | T-cell surface glycoprotein CD8 alph

Grade

ActiBioPure™, Animal Free, Bioactive, Carrier Free, PBS Only

Specifications & Purity

Animal Free, Carrier Free, Bioactive, ActiBioPure™, PBS Only, ≥95%(SDS-PAGE), See COA

Bioactivity

Immobilized Recombinant Human CD8 alpha protein (rp169572) at 1.0 μg/mL can bind CD8 alpha Mouse mAb (Ab095346) with the EC50 of 200.2 ng/mL.

Endotoxin Concentration

<1.0 EU/μg

Amino Acids

1-182 aa

Sequence

MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD

Accession #

P01732

Predicted molecular weight

18.3 kDa

SDS-PAGE

23.6-30.6 kDa, under reducing conditions; 24.7-29.7 & 48.2-54.4 kDa, under non-reducing conditions.

Molecule Type

Protein

Storage and Shipping

Concentration

See COA

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Storage

Store at -20°C,Avoid repeated freezing and thawing

Shipped In

Ice chest + Ice pads

Stability And Storage

Store at -20°C for 1 year. Avoid freeze/thaw cycle.

Images

ELISA: Recombinant Human CD8 alpha protein (rp169572)

Recombinant Human CD8 alpha protein (rp169572) - ELISA
Immobilized Recombinant Human CD8 alpha protein (rp169572) at 1.0 μg/mL can bind CD8 alpha Mouse mAb (Ab095346) with the EC₅₀ of 200.2 ng/mL.

SDS-PAGE: Recombinant Human CD8 alpha Protein (rp169572)

Recombinant Human CD8 alpha Protein (rp169572) - SDS-PAGE
3 μg/lane of Recombinant Human CD8 alpha Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 23.6-30.6 kDa under reducing conditions and 24.7-29.7 kDa and 48.2-54.4 under non-reducing conditions.
The protein appears as a dimer under non-reducing conditions due to the presence of disulfide bonds (Uniprot: P01732).