Recombinant Human Efgartigimod alfa Protein

Cat. No.: rp302524
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. ≥95%(SDS-PAGE) expressed in HEK293; See COA
Accession #
P01857
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
A titer ELISA of Recombinant Human Efgartigimod alfa Protein (rp302524). The plate was coated with different amounts of Recombinant Human Efgartigimod alfa Protein (rp302524). Goat Anti-Human IgG (HRP) (Ab175835) at 1/20000 dilution was used as the secondary antibody.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp302524-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$29.90
50μg
rp302524-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$84.90
100μg
rp302524-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$136.90
1mg
rp302524-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$616.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,≥95%(SDS-PAGE),expressed in HEK293; See COA ActiBioPure™,Animal Free,Bioactive,Carrier Free for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human Efgartigimod alfa Protein
Synonyms
IgG1 | Igh-4 | RGD1359539 | VH7183 | Efgartigimod alfa | IgG1 Fc
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, ≥95%(SDS-PAGE), expressed in HEK293; See COA
Biochemical and Physiological Mechanisms
IgG1 Fcplays a role in antigen binding activity and immunoglobulin receptor binding activity. IgG1 Fc takes part in the activation of immune & defensive response. IgG1 Fc takes part in the upstream of immunoglobulin mediated immune response, positive regu
Bioactivity
A titer ELISA of Recombinant Human Efgartigimod alfa Protein (rp302524). The plate was coated with different amounts of Recombinant Human Efgartigimod alfa Protein (rp302524). Goat Anti-Human IgG (HRP) (Ab175835) at 1/20000 dilution was used as the secondary antibody.
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
104-330 aa (M135Y, S137T, T139E, H316K, N317F)
Sequence
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLYITREPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALKFHYTQKSLSLSPGK​
Accession #
Predicted molecular weight
25.6 kDa
SDS-PAGE
31.0 kDa, under reducing conditions; 51.4 kDa, under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Concentration
expressed in HEK293; See COA
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃ for 12 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images
Recombinant Human Efgartigimod alfa Protein (rp302524) - ELISA 
A titer ELISA of Recombinant Human Efgartigimod alfa Protein (rp302524). The plate was coated with different amounts of Recombinant Human Efgartigimod alfa Protein (rp302524). Goat Anti-Human IgG (HRP) (Ab175835) at 1/20000 dilution was used as the secondary antibody.
Recombinant Human Efgartigimod alfa Protein (rp302524) - SDS-PAGE 
3 μg/lane of Recombinant Human Efgartigimod alfa Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 31.0 kDa under reducing conditions and 51.4 kDa under non-reducing conditions. Fc fusion proteins can be linked by disulfide bonds in the Fc hinge region to form stable dimers (PMID: 23665380).

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ26F0535853Certificate of AnalysisJun 02, 2026 rp302524
ZJ26F0535852Certificate of AnalysisJun 02, 2026 rp302524
ZJ26F0535851Certificate of AnalysisJun 02, 2026 rp302524
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.