Recombinant Human GDF8 / Myostatin Protein

Cat. No.: rp156335
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE) See COA
Accession #
O08689
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant human GDF8/Myostatin protein (rp156335) at 1.0 μg/mL can bind Domagrozumab (anti-GDF8) (Ab175511) with the EC50 of 33.4 ng/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp156335-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$233.90
50μg
rp156335-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$697.90
100μg
rp156335-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$1,117.90
1mg
rp156335-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$5,927.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,His Tag,PBS Only,≥95%(SDS-PAGE),See COA ActiBioPure™,Animal Free,Bioactive,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human GDF8 / Myostatin Protein
Synonyms
GDF8 | GDF-8 | GDF8growth differentiation factor 8 | growth/differentiation factor 8 | MSLHP | MSTN | Myostatin
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, His Tag, PBS Only
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, His Tag, PBS Only, ≥95%(SDS-PAGE), See COA
Biochemical and Physiological Mechanisms
GDF-8 / Myostatin / MSTN is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing se
Bioactivity
Immobilized Recombinant human GDF8/Myostatin protein (rp156335) at 1.0 μg/mL can bind Domagrozumab (anti-GDF8) (Ab175511) with the EC50 of 33.4 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
1-376​ aa
Sequence
MMQKLQMYVYIYLFMLIAAGPVDLNEGSEREENVEKEGLCNACAWRQNTRYSRIEAIKIQILSKLRLETAPNISKDAIRQLLPRAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQADGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVKTPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMSPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCSHHHHHH​
Accession #
Predicted molecular weight
40.9 kDa
SDS-PAGE
13.8 & 37.2 & 50.3 kDa, under reducing conditions
Molecule Type
Protein
Storage and Shipping
Concentration
See COA
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C for 1 year. Avoid freeze/thaw cycle.
Images

Recombinant human GDF8 / Myostatin protein (rp156335) - ELISA
Immobilized Recombinant human GDF8 / Myostatin protein (rp156335) at 1.0 μg/mL can bind Domagrozumab (anti-GDF8) (Ab175511) with the EC50 of 33.4 ng/mL.

Recombinant human GDF8 / Myostatin protein (rp156335) - SDS-PAGE
3 μg/lane of Recombinant human GDF8 / Myostatin protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 13.8 & 37.2 & 50.3 kDa under reducing.

This protein carries a polyhistidine tag at the N-terminus. The protein migrates as 13.8 kDa, 37.2 kDa and 50.3 kDa when calibrated against Protein Marker under reducing (R) condition (SDS-PAGE), speculated as mature GDF-8, propeptide and latent GDF-8 respectively due to glycosylation.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.