Recombinant Human L-Selectin/CD62L Protein

Cat. No.: rp183639
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE) See COA
Accession #
P14151
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. When 5 x 104 cells/well are added to Recombinant Human CD62L Protein (rp183639) coated plates (2 µg/mL with 100 µL/well), approximately 90-100% will adhere after 1 hour incubation at RT.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp183639-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$89.90
50μg
rp183639-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$249.90
100μg
rp183639-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$399.90
1mg
rp183639-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$1,999.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,His-Tag,≥95%(SDS-PAGE),See COA ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human L-Selectin/CD62L Protein
Synonyms
CD62L antigen | CD62L | gp90-MEL | hLHRc | LAM1 | LAM-1 | LAM1LECAM1 | LECAM1 | LEU8 | Leu-8 | Leukocyte adhesion molecule 1 | Leukocyte surface antigen Leu-8 | Leukocyte-endothelial cell adhesion molecule 1 | LNHR | LNHRTQ1 | LSEL | L-Selectin | LYAM1 |
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, His Tag
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, His-Tag, ≥95%(SDS-PAGE), See COA
Biochemical and Physiological Mechanisms
L-selectin (SELL), also known as CD62L, is a key adhesion molecule that regulates both the migration of leukocytes at sites of inflammation and the recirculation of lymphocytes between blood and lymphoid tissues. It belongs to the selectin family of prote
Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. When 5 x 104 cells/well are added to Recombinant Human CD62L Protein (rp183639) coated plates (2 µg/mL with 100 µL/well), approximately 90-100% will adhere after 1 hour incubation at RT.
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
1-332 aa
Sequence
MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNHHHHHH
Accession #
Predicted molecular weight
34.9 kDa
SDS-PAGE
45.0-68.0 kDa, under reducing conditions
Molecule Type
Protein
Storage and Shipping
Concentration
See COA
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃ for 12 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images
Recombinant Human L-Selectin/CD62L Protein (rp183639) - Protein Bioactivity 
Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. When 5 x 104 cells/well are added to Recombinant Human L-Selectin/CD62L Protein (rp183639) coated plates (2 µg/mL with 100 µL/well), approximately 90-100% will adhere after 1 hour incubation at RT.
Recombinant Human L-Selectin/CD62L Protein (rp183639) - SDS-PAGE 
3 μg/lane of Recombinant Human L-Selectin/CD62L Protein was resolved with SDS-PAGE under reducing (R) and visualized by Coomassie® Blue staining, showing a band at 45.0-68.0 kDa under reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ25F1230335Certificate of AnalysisDec 19, 2025 rp183639
ZJ25F1230334Certificate of AnalysisDec 19, 2025 rp183639
ZJ25F1230333Certificate of AnalysisDec 19, 2025 rp183639
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.