Recombinant Human Myoglobin Protein

Cat. No.: rp214420
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE) See COA
Accession #
P02144
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human Myoglobin Protein (rp214420) at 1.0 μg/mL can bind Recombinant Myoglobin Antibody (Ab007432) with the EC50 of 4.7 ng/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp214420-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$73.90
50μg
rp214420-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$259.90
100μg
rp214420-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$399.90
1mg
rp214420-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$2,599.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Bioactive,ActiBioPure™,His-Tag,≥95%(SDS-PAGE),See COA ActiBioPure™,Bioactive,Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human Myoglobin Protein
Synonyms
MB | MGC13548 | MYG_HUMAN | Myoglobin
Grade
ActiBioPure™, Bioactive, Carrier Free, His Tag
Specifications & Purity
Carrier Free, Bioactive, ActiBioPure™, His-Tag, ≥95%(SDS-PAGE), See COA
Biochemical and Physiological Mechanisms
Monomeric heme protein which primary function is to store oxygen and facilitate its diffusion within muscle tissues. Reversibly binds oxygen through a pentacoordinated heme iron and enables its timely and efficient release as needed during periods of heig
Bioactivity
Immobilized Recombinant Human Myoglobin Protein (rp214420) at 1.0 μg/mL can bind Recombinant Myoglobin Antibody (Ab007432) with the EC50 of 4.7 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
2-154 aa
Sequence
MHHHHHHGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Accession #
Predicted molecular weight
18.0 kDa
SDS-PAGE
17.4 kDa, under reducing conditions; 16.8 & 17.5 kDa, under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Concentration
See COA
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃ for 6 months. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images

Recombinant Human Myoglobin Protein (rp214420) - ELISA
Immobilized Recombinant Human Myoglobin Protein (rp214420) at 1.0 μg/mL can bind Recombinant Myoglobin Antibody (Ab007432) with the EC50 of 4.7 ng/mL.

Recombinant Human Myoglobin Protein (rp214420) - SDS-PAGE
3 μg/lane of Recombinant Human Myoglobin Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 17.4 kDa under reducing conditions and 16.8 & 17.5 kDa under non-reducing conditions.
Myoglobin is a protein consisting of a single alpha-helical structure containing a Heme group. It reversibly binds oxygen through pentacorated heme iron and releases oxygen in a timely and efficient manner as needed during periods of increased demand. The main reason for the existence of two conformations in the non-reducing state is related to the different spin states and coordination modes of iron (Fe) in the heme cogroup. (PubMed:30918256, PubMed:34679218)

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.