Recombinant Mouse AgRP Protein

Cat. No.: rp186584
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE) expressed in HEK293; See COA
Accession #
P56473
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Testing in progress
Size
Status
Price
Qty
10μg
rp186584-10μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$119.90
50μg
rp186584-50μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$329.90
100μg
rp186584-100μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$529.90
1mg
rp186584-1mg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
$2,699.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free, Carrier Free, His Tag, ≥95%(SDS-PAGE), expressed in HEK293; See COA Animal Free,Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Mouse AgRP Protein
Grade
Animal Free, Carrier Free, His Tag
Specifications & Purity
Animal Free, Carrier Free, His Tag, ≥95%(SDS-PAGE), expressed in HEK293; See COA
Biochemical and Physiological Mechanisms
Agouti-Related Protein (AgRP), the protein product of the Agouti-Related Transcript (ART), is a neuroprotein that regulates energy metabolism and the development of obesity by antagonizing alpha -melanocyte stimulating hormone ( alpha -MSH) action on MC-3
Bioactivity
Testing in progress
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
1-131 aa
Sequence
MLTAMLLSCVLLLALPPTLGVQMGVAPLKGIRRPDQALFPEFPGLSLNGLKKTTADRAEEVLLQKAEALAEVLDPQNRESRSPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRTHHHHHH
Accession #
Predicted molecular weight
13.2 kDa
SDS-PAGE
11.5 & 15.0-19.6 kDa, under reducing conditions; 25.2-29.6 kDa, under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Concentration
expressed in HEK293; See COA
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃ for 12 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images
Recombinant Mouse AgRP Protein (rp186584) - SDS-PAGE 
3 μg/lane of Recombinant Mouse AgRP Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the bands at 11.5 & 15.0-19.6 kDa under reducing conditions and 25.2-29.6 kDa under non-reducing conditions. The first 34 residues of AGRP (87-132) are well-ordered and contain a three-stranded antiparallel beta sheet, where the last two strands form a beta hairpin. The relative spatial positioning of the disulfide cross-links demonstrates that the ordered region of AGRP (87-132) adopts the inhibitor cystine knot (ICK) fold previously identified for numerous invertebrate toxins. This fold itself possesses structural and evolutionary propensities for dimerization (PMID: 11747427).

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Solution Calculators
Reviews

Customer Reviews

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Animal Free grade guide → View Carrier Free grade guide → View His Tag grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.