Recombinant Mouse CTLA-4 Protein

Cat. No.: rp153837
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. Fc tag ? Fc tag grade — recombinant protein bearing a Fc tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. The Fc tag aids dimerization and protein-A/G capture. ≥95%(SDS-PAGE)
Accession #
Q6GTR6
Protein Tag
C-His & hFc
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured by its ability to inhibit IL-2 secretion by stimulated Jurkat human acute T cell leukemia cells. The ED50 for this effect is 0.1-0.4 µg/mL when stimulated with 1 µg/mL Recombinant Human B7‑1/CD80 Fc Chimera in the presence of PHA.
Size
Status
Price
Qty
10μg
rp153837-10μg
9
$59.90
50μg
rp153837-50μg
4
$139.90
100μg
rp153837-100μg
4
$229.90
1mg
rp153837-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$1,439.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,His-Tag,Fc tag,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,Fc tag,High Performance,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Mouse CTLA-4 Protein
Synonyms
CD | CD152 antigen | CD152 | CD152IDDM12 | celiac disease 3 | CELIAC3 | CTLA4 | CTLA-4 | cytotoxic T-lymphocyte antigen 4 | cytotoxic T-lymphocyte protein 4 | Cytotoxic T-lymphocyte-associated antigen 4 | cytotoxic T-lymphocyte-associated protein 4 | cyto
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, Fc tag, High Performance, His Tag
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, His-Tag, Fc tag, ≥95%(SDS-PAGE)
Biochemical and Physiological Mechanisms
Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28. Post-translation
Bioactivity
Measured by its ability to inhibit IL-2 secretion by stimulated Jurkat human acute T cell leukemia cells. The ED50 for this effect is 0.1-0.4 µg/mL when stimulated with 1 µg/mL Recombinant Human B7‑1/CD80 Fc Chimera in the presence of PHA.
Endotoxin Concentration
<1.0 EU/μg
Species
Mouse
Amino Acids
37-162 aa
Sequence
AIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDFENLYFQGMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Accession #
Predicted molecular weight
41 kDa
SDS-PAGE
55 kDa, under reducing conditions
Molecule Type
Protein
Storage and Shipping
Shape
Lyophilized
Reconstitution
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle.
Images
Recombinant Mouse CTLA-4 Protein (rp153837) - SDS-PAGE 
2 μg/lane of Recombinant Mouse CTLA-4 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 52 - 60 kDa under reducing conditions and 110 - 125 kDa under non-reducing conditions.
Measured by its ability to inhibit IL-2 secretion by stimulated Jurkat human acute T cell leukemia cells. The ED₅₀ for this effect is 0.1-0.4 µg/mL when stimulated with 1 µg/mL Recombinant Human B7‑1/CD80 Fc Chimera in the presence of PHA. The ED₅₀ for this effect is 0.16 μg/mL.  

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ26F0131600Certificate of AnalysisJan 28, 2026 rp153837
ZJ26F0131599Certificate of AnalysisJan 28, 2026 rp153837
ZJ26F0131598Certificate of AnalysisJan 28, 2026 rp153837
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.