Recombinant Mouse CXCL17/VCC-1 Protein

Cat. No.: rp184867
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥90%(SDS-PAGE) See COA
Accession #
Q5UW37
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp184867-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$139.90
50μg
rp184867-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$399.90
100μg
rp184867-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$599.90
1mg
rp184867-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$2,999.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,His Tag,PBS Only,≥90%(SDS-PAGE),See COA Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Mouse CXCL17/VCC-1 Protein
Synonyms
Chemokine (C-X-C Motif) Ligand 17 | C-X-C Motif Chemokine 17 | CXCL17 | Dcip1 | Dendritic Cell And Monocyte Chemokine-Like Protein | DMC | UNQ473 | VCC1 | VCC-1 | VEGF Coregulated Chemokine 1 | VEGF Co-Regulated Chemokine 1
Grade
Carrier Free, His Tag, PBS Only
Specifications & Purity
Carrier Free, His Tag, PBS Only, ≥90%(SDS-PAGE), See COA
Biochemical and Physiological Mechanisms
Dendritic cell and monocyte chemokine-like protein (DMC), also known as VEGF-correlated chemokine-1 (VCC-1), is a secreted molecule with a size and predicted three-dimensional folding pattern similar to that of chemokines CXCL8/IL-8 and CXCL14/BRAK. It ha
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
23-119 aa
Sequence
MGSSHHHHHHSSGENLYFQ/SPNPGVARSHGDQHLAPRRWLLEGGQECECKDWFLQAPKRKATAVLGPPRKQCPCDHVKGREKKNRHQKHHRKSQRPSRACQQFLKRCHLASFALPL
Accession #
Predicted molecular weight
13.4 kDa
SDS-PAGE
10.1-18.1 kDa, under reducing conditions; 10.0-18.6 kDa, under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Concentration
See COA
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃ for 12 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images

Recombinant Mouse CXCL17/VCC-1 Protein (rp184867) - SDS-PAGE
2 μg/lane of Recombinant Mouse CXCL17/VCC-1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 10.1-18.1 kDa under reducing conditions and 10.0-18.6 & 26.0-30.8 kDa under non-reducing conditions.
The observation of  CXCL17/VCC-1 Protein as both dimers and monomers under non-reducing (NR) conditions suggests that a portion of the protein forms dimers. This dimerization may be mediated by (or stabilized by) disulfide bonds (Uniprot: Q5UW37).

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ26F0636316Certificate of AnalysisJun 12, 2026 rp184867
ZJ26F0636315Certificate of AnalysisJun 12, 2026 rp184867
ZJ26F0636314Certificate of AnalysisJun 12, 2026 rp184867
Solution Calculators
Reviews

Customer Reviews

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide → View His Tag grade guide → View PBS Only grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.