Determine the necessary mass, volume, or concentration for preparing a solution.
CART(55-102)(rat) acetate, CAS No.209615-79-2(free base)
AVAILABLE TO ORDER
GRADE & PURITY ≥95%
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
Why this grade
≥95% for sensitive chromatographic and analytical workflows requiring minimal baseline interference.
Storage & shipping
Store at -20°C Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.
Quality documents
SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.
Literature proof
Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.
Overview
CART(55-102)(rat) acetate
is a rat satiety factor with potent appetite-suppressing activity. CART(55-102)(rat) TFA is closely associated with leptin and neuropeptide Y. CART(55-102)(rat) TFA can induces anxiety and stress-related behavior
Specifications
Product Name
CART(55-102)(rat) acetate, CAS No.209615-79-2(free base)
Specifications & Purity
≥95%
Biochemical and Physiological Mechanisms
Cocaine- and amphetamine-regulated transcript (CART) with potent appetite-suppressing activity. Satiety factor; inhibits normal and starvation-induced feeding. Closely related to the actions of leptin and neuropeptide Y; blocks the neuropeptide Y-induced
Sequence
IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL(Modifications: Disulfide bridge between 14 - 32, 20 - 40, 34 - 47)
CAS
209615-79-2(free base)
Molecule Type
Peptide
Storage and Shipping
Storage
Store at -20°C
Shipped In
Ice chest + Ice pads
Documentation
📋 Safety Data Sheet (SDS)
Comprehensive hazard, handling, storage, and regulatory compliance document.
Download SDS →✅ Certificate of Analysis (COA)
Lot-specific quality data. Enter your lot number to retrieve the exact COA.
Look up COA →🔬 Specification Sheet
Full quality attributes and acceptance criteria for this grade.
View spec sheet →Advanced Data
Certificates（CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Solution Calculators
Reviews
Customer Reviews
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.