Recombinant Bovine Growth Hormone (GH) Protein

Cat. No.: rp231886
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. ≥95%(SDS-PAGE)
Accession #
P01246
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
The activity as determined by the PDFP13B9 cells stably transfected with rabbit GH receptors. Bovine GH is also capable of forming a 1:2 complex with the recombinant ovine growth hormone receptor extracellular domain (ECD).
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp231886-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$29.90
50μg
rp231886-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$89.90
100μg
rp231886-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$139.90
1mg
rp231886-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$699.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

ActiBioPure™, Animal Free, Carrier Free, Bioactive, High Performance, ≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Bovine Growth Hormone (GH) Protein
Synonyms
GH1 | GHB5 | GHIGHD1B | GHN | GH-N | GHNGrowth hormone | GH-Nsomatotropin | growth hormone 1Pituitary growth hormone | Growth Hormone | hGH-N | IGHD1A | IGHD2 | Somatotropin
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance
Specifications & Purity
ActiBioPure™, Animal Free, Carrier Free, Bioactive, High Performance, ≥95%(SDS-PAGE)
Biochemical and Physiological Mechanisms
Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake a
Bioactivity
The activity as determined by the PDFP13B9 cells stably transfected with rabbit GH receptors. Bovine GH is also capable of forming a 1:2 complex with the recombinant ovine growth hormone receptor extracellular domain (ECD).
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
27-217 aa
Sequence
AFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGILALMRELEDGTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMKCRRFGEASCAF
Accession #
Predicted molecular weight
21.8 kDa
SDS-PAGE
22 kDa, under reducing conditions.
Molecule Type
Protein
Storage and Shipping
Reconstitution
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20~-80℃ long term (1 year). Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.