Recombinant Human beta-NGF Protein

Cat. No.: rp174635
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥90%(SDS-PAGE&SEC-HPLC)
Accession #
P01138
Protein Tag
No tag
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells.The ED50 for this effect is 0.04-0.4 ng/mL.
Size
USA
Germany (EU)*
Price
Qty
10μg
rp174635-10μg
US Made to order · 2–4 wks ·
$79.90
50μg
rp174635-50μg
US Made to order · 2–4 wks ·
$279.90
500μg
rp174635-500μg
US Made to order · 2–4 wks ·
$1,879.90
1mg
rp174635-1mg
US Made to order · 2–4 wks ·
$2,999.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,PBS Only,≥90%(SDS-PAGE&SEC-HPLC) ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human beta-NGF Protein
Synonyms
beta-nerve growth factor | beta-NGF | Oxervate,Sentinel | Beta nerve growth factor | Beta NGF | HSAN5 | MGC161426 | MGC161428 | Nerve growth factor | Nerve growth factor (beta polypeptide) | Nerve growth factor beta | Nerve growth factor beta polypeptide
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, PBS Only
Specifications & Purity
Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,PBS Only,≥90%(SDS-PAGE&SEC-HPLC)
Biochemical and Physiological Mechanisms
Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to reg
Bioactivity
Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells.The ED50 for this effect is 0.04-0.4 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
122-239 aa
Sequence
SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVR
Accession #
Predicted molecular weight
13.3 KDa
SDS-PAGE
14 KDa, under reducing conditions
Molecule Type
Protein
Storage and Shipping
Reconstitution
Always centrifuge tubes before opening.Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100μg/mL. Dissolve the lyophilized protein in distilled water. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Lyophilized protein should be stored at ≤ -20°C, stable for one year after receipt. Reconstituted protein solution can be stored at 2-8°C for 2-7 days. Aliquots of reconstituted samples are stable at ≤ -20°C for 3 months. Upon receipt, it is recommended t
Images

Recombinant Human beta-NGF Protein - Protein Bioactivity
Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED₅₀ for this effect is 0.04 - 0.4 ng/mL.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ26F0838714Certificate of AnalysisSep 01, 2026 rp174635
ZJ26F0838713Certificate of AnalysisSep 01, 2026 rp174635
ZJ25F0217813Certificate of AnalysisFeb 12, 2025 rp174635
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.