Carrier Free,His-Tag,≥95%(SDS-PAGE),See COA Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name

Recombinant Human CKS2 Protein

Synonyms

CDC28 protein kinase 2, CDC28 protein kinase regulatory subunit 2, CKS1(S. cerevisiae Cdc28/Cdc2 kinase subunit) homolog-2, CKS-2, CKSHS2, cyclin-dependent kinases regulatory subunit 2

Grade

Carrier Free, His Tag

Specifications & Purity

Carrier Free, His-Tag, ≥95%(SDS-PAGE), See COA

Biochemical and Physiological Mechanisms

CKS2, also known as CDC28 Protein kinase 2 associates with the catalytic subunit of cyclin-dependent kinases and has therefore been assumed to play a direct role in cell cycle regulation. The function of CKS2 in somatic mammalian cells is not well underst

Endotoxin Concentration

<1.0 EU/μg

Amino Acids

2-79 aa

Sequence

MHHHHHHAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK

Accession #

P33552

Predicted molecular weight

10.7 kDa

SDS-PAGE

12.0 kDa, under reducing conditions; 12.0 kDa, under non-reducing conditions.

Molecule Type

Protein

Storage and Shipping

Concentration

See COA

Storage

Store at -20°C,Avoid repeated freezing and thawing

Shipped In

Ice chest + Ice pads

Stability And Storage

Store at -20°C for 1 year. Avoid freeze/thaw cycle.

Images

SDS-PAGE: Recombinant Human CKS2 Protein (rp188488)

Recombinant Human CKS2 Protein (rp188488) - SDS-PAGE
3 μg/lane of Recombinant Human CKS2 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 12.0 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot Number	Certificate Type	Date	Item
ZJ25F0116484	Certificate of Analysis	Jul 10, 2026	rp188488
ZJ25F0116485	Certificate of Analysis	Jul 10, 2026	rp188488
ZJ25F0116486	Certificate of Analysis	Jul 10, 2026	rp188488

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Reconstitution Calculator

Reviews

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide → View His Tag grade guide →

Bulk & Custom Packaging Need larger quantities or custom specifications? Contact our team for a tailored quote.

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.

Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.