Recombinant Human FGF-17 Protein

Cat. No.: rp183585
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
E. coli
Accession #
O60258
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured in a cell proliferation assay using BALB/c mouse embryos cells. The ED50 for this effect is 0.80 μg/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp183585-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$107.90
50μg
rp183585-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$399.90
100μg
rp183585-100μg
2
$659.90
1mg
rp183585-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$3,399.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Bioactive,ActiBioPure™,High Performance,His Tag,PBS Only,≥95%(SDS-PAGE) ActiBioPure™,Bioactive,Carrier Free,High Performance,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

FGF-13, also known as FGF17, belongs to the fibroblast growth factor (FGF) family. Members of this family show broad mitogenic and cell survival activities, and play a role in a variety of biological processes including embryonic development cell growth, morphogenesis, tissue repair, tumor growth and invasion. FGF-13 is preferentially expressed in the embryonic brain. It interacts with FGFR3 and FGFR4. FGF-13 plays an important role in the regulation of embryonic development and as signaling molecule in the induction and patterning of the embryonic brain. It is also required for normal brain development. 

Specifications

Product Name
Recombinant Human FGF-17 Protein
Synonyms
FGF-13 | FGF17 | FGF-17 | fibroblast growth factor 17 | HH20
Grade
ActiBioPure™, Bioactive, Carrier Free, High Performance, His Tag, PBS Only
Specifications & Purity
Carrier Free, Bioactive, ActiBioPure™, High Performance, His Tag, PBS Only, ≥95%(SDS-PAGE)
Bioactivity
Measured in a cell proliferation assay using BALB/c mouse embryos cells. The ED50 for this effect is 0.80 μg/mL.
Endotoxin Concentration
<1.0 EU/μg
Expression System
E. coli
Amino Acids
23-216 aa
Sequence
MHHHHHHTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT
Protein Tag
N-His
Accession #
Predicted molecular weight
23.5 kDa
SDS-PAGE
26.5 kDa, under reducing conditions; 26.5 kDa, under non-reducing conditions
Molecule Type
Protein
Storage and Shipping
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Images

Recombinant Human FGF-17 Protein (rp183585) - Protein Bioactivity
Measured in a cell proliferation assay using BALB/c mouse embryos cells. The ED₅₀ for this effect is 0.80 μg/mL.

Recombinant Human FGF-17 Protein (rp183585) - SDS-PAGE
1.5 μg/lane of Recombinant Human FGF-17 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 26.5 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ25F1028409Certificate of AnalysisOct 22, 2025 rp183585
ZJ25F1028408Certificate of AnalysisOct 22, 2025 rp183585
ZJ24R0800891Certificate of AnalysisAug 09, 2024 rp183585
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.