Recombinant Human FGF basic/FGF2/bFGF GMP Protein

Cat. No.: rp166699-GMP
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. ≥97%(SDS-PAGE&SEC-HPLC)
Expression System
E. coli
Accession #
P09038-4
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<0.01 EU/μg
Bioactivity
Measured in a cell proliferation assay using NR6R‑3T3 mouse fibroblast cells. The ED50 for this effect is 0.100-1.00 ng/mL. The specific activity of Recombinant Human FGF basic/FGF2 GMP is >8.0 x 10^5 IU/mg, which is calibrated against the human FGF basic/FGF2 WHO International Standard (NIBSC code: 90/712).
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
25μg
rp166699-GMP-25μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.

$222.90

$289.90
Save $67.00 (23.11%)
1mg
rp166699-GMP-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$3,769.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,≥97%(SDS-PAGE&SEC-HPLC) ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human FGF basic/FGF2/bFGF GMP Protein
Synonyms
Fibroblast Growth Factor basic | basic fibroblast growth factor bFGF | Basic fibroblast growth factor | bFGF | FGF basic | FGF2 | FGF-2 | FGFB | prostatropin | fibroblast growth factor 2 (basic) | HBGF-2 | heparin-binding growth factor 2
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, ≥97%(SDS-PAGE&SEC-HPLC)
Biochemical and Physiological Mechanisms
Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Binds to integrin ITGAV:ITGB3. Plays an important role in the regulation of cell survival, cell division, cell differentiation and ce
Bioactivity
Measured in a cell proliferation assay using NR6R‑3T3 mouse fibroblast cells. The ED50 for this effect is 0.100-1.00 ng/mL. The specific activity of Recombinant Human FGF basic/FGF2 GMP is >8.0 x 10^5 IU/mg, which is calibrated against the human FGF basic/FGF2 WHO International Standard (NIBSC code: 90/712).
Endotoxin Concentration
<0.01 EU/μg
Expression System
E. coli
Amino Acids
135-288 aa
Sequence
AAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Protein Tag
No tag
N-terminal Sequence
Ala135-Ala-Gly-Ser-Ile-Thr-Thr-Leu-Pro-Ala Ala136-Gly-Ser-Ile-Thr-Thr-Leu-Pro-Ala-Leu
Accession #
Predicted molecular weight
17 kDa
SDS-PAGE
18 kDa under reducing conditions.
Molecule Type
Protein
Storage and Shipping
Reconstitution
Reconstitute 25 μg size at 250 μg/mL and all other sizes at 500 μg/mL in sterile water.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
A minimum of 12 months when stored at ≤ -20 ℃ as supplied. 1 month, 2 to 8 ℃ under sterile conditions after reconstitution. 3 months, ≤ -20 ℃ under sterile conditions after reconstitution. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycl

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.