Recombinant Human GDNF GMP Protein

Cat. No.: rp168357-GMP
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥97%(SDS-PAGE&SEC-HPLC)
Expression System
HEK293
Accession #
P39905-1
Protein Tag
No tag
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured in a cell proliferation assay using SH‑SY5Y human neuroblastoma cells. The ED50 for this effect is 2-12 ng/mL in the presence of Recombinant Human GFRα‑1/GDNF Rα‑1 Fc Chimera. The specific activity of recombinant human GDNF is >5.0 x 10^5 units/mg, which is calibrated against the human GDNF Reference Standard (NIBSC code: 09/266). Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human GFRα‑1/GDNF Rα‑1 Fc Chimera at 1 µg/mL can bind Recombinant Human GDNF with an apparent Kd <1 nM.
Size
Status
Price
Qty
10μg
rp168357-GMP-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.

$419.90

$549.90
Save $130.00 (23.64%)
50μg
rp168357-GMP-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.

$1,002.90

$1,829.90
Save $827.00 (45.19%)
1mg
rp168357-GMP-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.

$9,879.90

$14,639.90
Save $4,760.00 (32.51%)
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,PBS Only,≥97%(SDS-PAGE&SEC-HPLC) ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human GDNF GMP Protein
Synonyms
Glial Cell line-derived Growth Factor | Astrocyte-derived trophic factor | ATF | ATF1 | ATF2 | GDNF | glial cell derived neurotrophic factor | glial cell line derived neurotrophic factor | glial cell line-derived neurotrophic factor | HFB1-GDNF | HGDNF |
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, PBS Only
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, PBS Only, ≥97%(SDS-PAGE&SEC-HPLC)
Biochemical and Physiological Mechanisms
Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake. Acts by binding to its coreceptor, GFRA1, leading to autophosphorylation and activation of the RET rece
Bioactivity
Measured in a cell proliferation assay using SH‑SY5Y human neuroblastoma cells. The ED50 for this effect is 2-12 ng/mL in the presence of Recombinant Human GFRα‑1/GDNF Rα‑1 Fc Chimera. The specific activity of recombinant human GDNF is >5.0 x 10^5 units/mg, which is calibrated against the human GDNF Reference Standard (NIBSC code: 09/266). Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human GFRα‑1/GDNF Rα‑1 Fc Chimera at 1 µg/mL can bind Recombinant Human GDNF with an apparent Kd <1 nM.
Endotoxin Concentration
<1.0 EU/μg
Expression System
HEK293
Amino Acids
109-211 aa
Sequence
RGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
Protein Tag
No tag
N-terminal Sequence
-Arg109-Gly-Gln-Arg-Gly-Lys-Asn-Arg-Gly-(Cys)
Accession #
Predicted molecular weight
11.6 kDa (monomer)
SDS-PAGE
17 kDa, reducing conditions. 33 kDa, non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Reconstitution
Reconstitute at 100 μg/mL in PBS.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
A minimum of 12 months when stored at ≤ -20 ℃ as supplied. 1 month, 2 to 8 ℃ under sterile conditions after reconstitution. 3 months, ≤ -20 ℃ under sterile conditions after reconstitution. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycl

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.