Recombinant Human Glutathione Peroxidase 4 Protein

Cat. No.: rp220388
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥90%(SDS-PAGE) See COA
Accession #
P36969
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp220388-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$159.90
50μg
rp220388-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$459.90
100μg
rp220388-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$733.90
1mg
rp220388-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$4,779.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,His-Tag,≥90%(SDS-PAGE),See COA Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human Glutathione Peroxidase 4 Protein
Synonyms
Glutathione peroxidase 4 | GPX 4 | GPX-4 | GPX4 | GPX4_HUMAN | GSHPx-4 | MCSP | mitochondrial | PHGPx | Phospholipid hydroperoxidase | Phospholipid hydroperoxide glutathione peroxidase | Phospholipid hydroperoxide glutathione peroxidase mitochondrial | sn
Grade
Carrier Free, His Tag
Specifications & Purity
Carrier Free, His-Tag, ≥90%(SDS-PAGE), See COA
Biochemical and Physiological Mechanisms
Protects cells against membrane lipid peroxidation and cell death. Required for normal sperm development and male fertility. Could play a major role in protecting mammals from the toxicity of ingested lipid hydroperoxides. Essential for embryonic developm
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
30-197 aa (U73C)
Sequence
MHHHHHHASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQCGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF
Accession #
Predicted molecular weight
20.6 kDa
SDS-PAGE
19.6 kDa, under reducing conditions; 18.3 & 36.0 & 53.7 kDa, under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Concentration
See COA
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃ for 6 months. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images

Recombinant Human Glutathione Peroxidase 4 Protein (rp220388) - SDS-PAGE
3 μg/lane of Recombinant Human Glutathione Peroxidase 4 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 19.6 kDa under reducing conditions and 18.3 & 36.0 & 53.7 kDa under non-reducing conditions.
The 30-197 amino acid fragment of the GPX4 protein may lack native structural domains, leading to exposure of hydrophobic regions and consequently increasing aggregation propensity. Additionally, substitution of selenocysteine (Sec) with cysteine (Cys) at position 73 (U73C) may enable the introduced Cys residue to form non-native disulfide bonds with adjacent cysteine residues, triggering intermolecular crosslinking and resulting in the formation of dimers or multimers (Uniprot ID: P36969).

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide → View His Tag grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.